ID AY050649; SV 1; linear; mRNA; STD; VRL; 672 BP. XX AC AY050649; XX DT 31-DEC-2004 (Rel. 82, Created) DT 16-APR-2005 (Rel. 83, Last updated, Version 2) XX DE Cymbidium mosaic virus coat protein mRNA, complete cds. XX KW . XX OS Cymbidium mosaic virus OC Viruses; Riboviria; Tymovirales; Alphaflexiviridae; Potexvirus. XX RN [1] RP 1-672 RA Ajjikuttira P., Ryu K.H., Loh C.S., Wong S.M.; RT "Variability in the coat protein gene of Cymbidium mosaic potexvirus"; RL Unpublished. XX RN [2] RP 1-672 RA Ajjikuttira P., Ryu K.H., Loh C.S., Wong S.M.; RT ; RL Submitted (13-AUG-2001) to the INSDC. RL Biological Sciences, National University of Singapore, Block S2, 14 Science RL Drive 4 117543, Singapore XX DR MD5; 412ce6d4f6ae576ba1e3d48cbac78e98. XX FH Key Location/Qualifiers FH FT source 1..672 FT /organism="Cymbidium mosaic virus" FT /host="Cattleya" FT /mol_type="mRNA" FT /note="isolated from Korea" FT /db_xref="taxon:12178" FT CDS 1..672 FT /codon_start=1 FT /product="coat protein" FT /note="functions in viral encapsidation" FT /db_xref="GOA:Q5JCM6" FT /db_xref="InterPro:IPR000052" FT /db_xref="UniProtKB/TrEMBL:Q5JCM6" FT /protein_id="AAL12627.1" FT /translation="MGEPTPTPAATYSAADPTSAPKLADLTAIKYSPVTSSIATPEEIK FT AITQLWVNNLGLPADTVGTAAIDLARAYADVGASKSATLLGFCPTKPDVRRAALAAQIF FT VANVTPRQFCAYYAKVVWNLMLATNDPPANWAKAGFQEDTRFAAFDFFDAVDSTAALEP FT AEWQRRPTDRERAAHSIGKYGALARQRIQNGNLITNIAEVTKGHLGFTNTLYALPAPPT FT E" XX SQ Sequence 672 BP; 131 A; 243 C; 158 G; 140 T; 0 other; atgggagagc ccactccaac tccagctgcc acttattccg ctgccgaccc cacttctgca 60 cccaagttgg ccgacctgac tgccattaag tactcacctg tcacctcctc cattgccacc 120 cccgaagaaa tcaaggctat aacccaattg tgggttaaca accttggcct ccccgccgac 180 acagtaggta ccgcggccat tgacctggcc cgcgcctacg ctgacgtcgg ggcgtccaag 240 agtgctaccc tgctcggttt ctgccctacg aaacctgatg tccgtcgcgc cgctcttgcc 300 gcgcagatct tcgtggccaa cgtcaccccc cgccagtttt gcgcttacta cgcaaaagtg 360 gtgtggaatc tgatgctggc cactaacgat ccgcccgcca actgggccaa ggctggtttc 420 caggaggata cccggtttgc cgcctttgac ttcttcgatg ccgtcgattc cactgccgcg 480 ctggagcctg ctgaatggca gcgccgccct actgaccgtg aacgtgctgc gcactcgatc 540 gggaagtacg gcgcccttgc ccgtcagcgt atccaaaacg gcaacctcat caccaacatt 600 gccgaggtca ccaagggcca tcttggcttc accaacactc tctatgctct gcctgcaccc 660 cctaccgaat aa 672 //