ID AM498083; SV 1; linear; genomic DNA; STD; VRL; 436 BP. XX AC AM498083; XX DT 21-MAR-2007 (Rel. 91, Created) DT 03-AUG-2007 (Rel. 92, Last updated, Version 2) XX DE Tomato yellow leaf curl virus-Mild Mp gene for movement protein and partial DE CP gene for coat protein, isolated from Petite ile, Reunion, isolate 02_2 XX KW coat protein; CP gene; movement protein; Mp gene. XX OS Tomato yellow leaf curl virus - Mild OC Viruses; Geminiviridae; Begomovirus. XX RN [1] RP 1-436 RA Delatte H.; RT ; RL Submitted (21-FEB-2007) to the INSDC. RL Delatte H., Plant Protection, Cirad, 7, chemin de l'IRAT, 97410 Saint RL Pierre, REUNION. XX RN [2] RX DOI; 10.1007/s00239-007-0005-x. RX PUBMED; 17609843. RA Delatte H., Holota H., Moury B., Reynaud B., Lett J.M., Peterschmitt M.; RT "Evidence for a founder effect after introduction of Tomato yellow leaf RT curl virus-mild in an insular environment"; RL J. Mol. Evol. 65(1):112-118(2007). XX DR MD5; e0d62a29907692a02f2676fe99860aa1. XX FH Key Location/Qualifiers FH FT source 1..436 FT /organism="Tomato yellow leaf curl virus - Mild" FT /isolate="02_2" FT /mol_type="genomic DNA" FT /country="Reunion:Petite ile" FT /collection_date="2000" FT /identified_by="Delatte Helene" FT /db_xref="taxon:220944" FT CDS 81..431 FT /gene="Mp" FT /product="movement protein" FT /db_xref="GOA:Q5DVD2" FT /db_xref="InterPro:IPR002511" FT /db_xref="InterPro:IPR005159" FT /db_xref="UniProtKB/TrEMBL:Q5DVD2" FT /protein_id="CAM56921.1" FT /translation="MWDPLLNEFPESVHGFRCMLAIKYLQSVEETYEPNTLGHDLIRDL FT ISVVRARDYVEATRRYNHFHARLEGSPKAELRQPIQQPCCCPHCPRHKQATIMDVQAHV FT PEAQNIQNVSKP" FT CDS 241..>435 FT /gene="CP" FT /product="coat protein" FT /db_xref="GOA:A4FSM1" FT /db_xref="InterPro:IPR000263" FT /db_xref="UniProtKB/TrEMBL:A4FSM1" FT /protein_id="CAM56922.1" FT /translation="MSKRPGDIIISTPASKVRRRLNFDSPYSSRAAVPIVQGTNKRRSW FT TYRPMYRKPRIYRMYRSPDV" XX SQ Sequence 436 BP; 117 A; 101 C; 94 G; 124 T; 0 other; aatcaaattg catccttaaa cgttagataa gtgttcattt gtctttatat acttggtccc 60 caagtagttt gtcttgcaat atgtgggatc cacttttaaa tgaatttcct gaatctgttc 120 acggatttcg ttgtatgtta gctattaaat atttgcagtc cgttgaggaa acttacgagc 180 ccaatacatt gggccacgat ttaattaggg atcttatatc tgttgtaagg gcccgtgact 240 atgtcgaagc gaccaggcga tataatcatt tccacgcccg cctcgaaggt tcgccgaagg 300 ctgaacttcg acagcccata cagcagccgt gctgctgtcc ccattgtcca aggcacaaac 360 aagcgacgat catggacgta caggcccatg taccggaagc ccagaatata cagaatgtat 420 cgaagccctg atgttc 436 //