ID AM398154; SV 1; linear; genomic RNA; STD; VRL; 571 BP. XX AC AM398154; XX DT 07-SEP-2006 (Rel. 89, Created) DT 08-SEP-2006 (Rel. 89, Last updated, Version 2) XX DE Odontoglossum ringspot virus CP gene for coat protein, genomic RNA, DE isolated from Phalaenopsis leaf XX KW coat protein; CP gene. XX OS Odontoglossum ringspot virus OC Viruses; Riboviria; Virgaviridae; Tobamovirus. XX RN [1] RP 1-571 RA Xu Y.; RT ; RL Submitted (01-SEP-2006) to the INSDC. RL Xu Y., Genetics, Hangzhou Normal College, 16, Xueling-Street, Xiasha, RL Hangzhou, China, 310016, CHINA. XX RN [2] RA Xu Y.; RT "Pathological ultrastructural alteration and molecular identification of RT Phalaenopsis complex infected with Cymbidium C virus and Odontoglossum RT ringspot virus"; RL Unpublished. XX RN [3] RA Shi N.N., Xu Y.; RT "Pathological ultrastructural alteration and molecular identification of RT Phalaenopsis complex infected with Cymbidium C virus and Odontoglossum RT ringspot virus"; RL Unpublished. XX DR MD5; 78193e11d3a8e460595a933c0f34bb5f. XX FH Key Location/Qualifiers FH FT source 1..571 FT /organism="Odontoglossum ringspot virus" FT /mol_type="genomic RNA" FT /country="China:HangZhou" FT /isolation_source="Phalaenopsis leaf" FT /db_xref="taxon:12238" FT CDS 51..527 FT /gene="CP" FT /product="coat protein" FT /db_xref="GOA:O12854" FT /db_xref="InterPro:IPR001337" FT /db_xref="InterPro:IPR036417" FT /db_xref="UniProtKB/TrEMBL:O12854" FT /protein_id="CAL38760.1" FT /translation="MSYTITDPSKLAYLSSAWADPNSLINLCTNSLGNQFQTQQARTTV FT QQQFADVWQPVPTLTSRFPAGAGYFRVYRYDPILDPLITFLMGTFDTRNRIIEVENPQN FT PTTTETLDATRRVDDATVAIRSAINNLLNELVRGTGMYNQVSFETMSGLTWTSS" XX SQ Sequence 571 BP; 168 A; 113 C; 115 G; 172 T; 3 other; gnnnatgaga gatccgagtc atttgacgca caatctgatt cgtattgaat atgtcttaca 60 ctattacaga cccgtctaag ctggcttatt taagctcggc ttgggctgac cccaattcac 120 taatcaacct ttgtaccaat tctctgggta atcagttcca aacacaacaa gctcgaacaa 180 ctgttcaaca gcagtttgct gatgtttggc agccggttcc tactttgacc agtaggttcc 240 ctgcaggcgc tggttacttc agagtttatc gctatgatcc tatattagat cctttaataa 300 ctttcttaat gggtactttt gatactcgta atagaataat cgaggtagaa aatccgcaga 360 atccgacaac tacggaaaca ttagatgcaa ctcgtagagt tgatgatgca actgtagcaa 420 taagatctgc aataaataat ctattaaatg agttagttag gggaactggt atgtacaatc 480 aagtctcatt tgagacgatg tctggactta cttggacctc ttcctaatca tatttaggaa 540 aataacgttg atagtgttga actaacgggg g 571 //