ID AM261665; SV 1; linear; genomic DNA; STD; VRL; 526 BP. XX AC AM261665; XX DT 12-MAY-2006 (Rel. 87, Created) DT 12-MAY-2006 (Rel. 87, Last updated, Version 1) XX DE Tobacco curly shoot virus AV2 gene for pre-coat protein and partial AV1 DE gene for coat protein, isolate Y289 XX KW AV1 gene; AV2 gene; coat protein; pre-coat protein. XX OS Tobacco curly shoot virus OC Viruses; Geminiviridae; Begomovirus. XX RN [1] RP 1-526 RA Zhou X.; RT ; RL Submitted (04-MAY-2006) to the INSDC. RL Zhou X., Zhejiang University, Institute of Biotechnology, No.268, Kaixuan RL Road, Hangzhou, Zhejiang, 310029, CHINA. XX RN [2] RA Liao B., Zhou X.; RT "Rapid Detection of geminiviruses infecting Crops and Weeds in Yunnan"; RL Unpublished. XX DR MD5; b4ba3b99238cd0a0f21c8b2502f3499f. XX FH Key Location/Qualifiers FH FT source 1..526 FT /organism="Tobacco curly shoot virus" FT /isolate="Y289" FT /mol_type="genomic DNA" FT /country="China:Yunnan" FT /isolation_source="tobacco" FT /db_xref="taxon:180526" FT CDS 143..499 FT /gene="AV2" FT /product="pre-coat protein" FT /db_xref="GOA:Q1JRH4" FT /db_xref="InterPro:IPR002511" FT /db_xref="InterPro:IPR005159" FT /db_xref="UniProtKB/TrEMBL:Q1JRH4" FT /protein_id="CAK12546.1" FT /translation="MWDPLVNEFPETVHGFRCMLAVKYLQLVEKTYSPDTLGHDLIRDL FT ISVIRARNYVEATSRYNHFHARFEGTPPSQLRQPICEPCCCPHCPRHQSKSMGEQANEQ FT KAQDVQDVQKSRCP" FT CDS 303..>526 FT /gene="AV1" FT /product="coat protein" FT /db_xref="GOA:Q1JRH6" FT /db_xref="InterPro:IPR000263" FT /db_xref="UniProtKB/TrEMBL:Q1JRH6" FT /protein_id="CAK12547.1" FT /translation="MSKRPADIIISTPASKVRRRLNFDSPYVSRAAAPIVRVTKARAWA FT NRPMNRKPRMYRMYRSPDVPRGCEGPCKV" XX SQ Sequence 526 BP; 144 A; 124 C; 118 G; 140 T; 0 other; taatattacc gggtggaccg cgattttttt ttaaagtggg ccccttgatg tgatatgtca 60 tccaatcaat acgctccccc aaagcttaat tgttctgtgg tcccttattt aaacttgctc 120 accaagtact gcactccgca ctatgtggga tccattagta aacgagtttc ccgaaaccgt 180 tcacggcttt aggtgtatgt tagcagttaa atatctgcag ttagtagaga agacttattc 240 tcctgacaca ttaggtcacg atttaattag ggatttaatt tcagtaatta gggctagaaa 300 ttatgtcgaa gcgaccagca gatataatca tttccacgcc cgcttcgaag gtacgccgcc 360 gtctcaactt cgacagccca tatgtgagcc gtgctgctgc ccccattgtc cgcgtcacca 420 aagcaagagc atgggcgaac aggccaatga acagaaagcc caggatgtac aggatgtaca 480 gaagtccaga tgtccctaga ggatgtgaag ggccatgtaa agtcca 526 //