ID AM236022; SV 1; linear; genomic RNA; STD; VRL; 645 BP. XX AC AM236022; XX DT 01-APR-2006 (Rel. 87, Created) DT 24-MAR-2007 (Rel. 91, Last updated, Version 2) XX DE Cymbidium mosaic virus partial CP gene for coat protein, isolate RUN01, DE genomic RNA XX KW coat protein; CP gene. XX OS Cymbidium mosaic virus OC Viruses; Riboviria; Tymovirales; Alphaflexiviridae; Potexvirus. XX RN [1] RP 1-645 RA Grisoni M.; RT ; RL Submitted (10-MAR-2006) to the INSDC. RL Grisoni M., UMR 53-PVBMT, Cirad, 97410, 97410 Saint Pierre, REUNION. XX RN [2] RX DOI; 10.1007/s00705-006-0897-6. RX PUBMED; 17216134. RA Moles M., Delatte H., Farreyrol K., Grisoni M.; RT "Evidence that Cymbidium mosaic virus (CymMV) isolates divide into two RT subgroups based on nucleotide diversity of coat protein and replicase RT genes"; RL Arch. Virol. 152(4):705-715(2007). XX DR MD5; 11a7528b4b37514fb50b107c3fd2e4b6. XX FH Key Location/Qualifiers FH FT source 1..645 FT /organism="Cymbidium mosaic virus" FT /host="Vanilla planifolia" FT /isolate="RUN01" FT /mol_type="genomic RNA" FT /country="Reunion" FT /db_xref="taxon:12178" FT CDS 1..>645 FT /gene="CP" FT /product="coat protein" FT /db_xref="GOA:Q1XE54" FT /db_xref="InterPro:IPR000052" FT /db_xref="UniProtKB/TrEMBL:Q1XE54" FT /protein_id="CAJ84629.1" FT /translation="MGEPTPTPAATYSAADPTSAPKLADLAAIKYSPVTSSIATPEEIK FT AITQLWVNNLGLPADTVGTAAIDLARAYADVGASKSATLLGFCPTKPDVRRAALAAQIF FT VANVTPRQFCAYYAKVVWNLMLATNDPPANWAKAGFQEDTRFAAFDFFDAVDSTAALEP FT AEWQRRPTDRERAAHSIGKYGALARQRIQNGNLITNIAEVTKGHLGSTNTLY" XX SQ Sequence 645 BP; 123 A; 236 C; 156 G; 130 T; 0 other; atgggagagc ccactccaac tccagctgcc acttactccg ctgccgaccc cacttctgca 60 cccaagttgg ccgacctggc tgccattaag tactcgcctg tcacctcctc catcgccacc 120 cccgaggaaa tcaaggccat aacccaattg tgggttaaca accttggcct ccccgctgac 180 accgtaggta ccgcggccat tgacctggcc cgcgcctatg ctgacgtcgg agcgtccaag 240 agtgctaccc tgctcggttt ctgccctacg aaacctgatg tccgccgcgc cgctcttgcc 300 gcgcagatct tcgtggccaa cgtcaccccc cgccagtttt gcgcttacta cgcaaaagtg 360 gtgtggaatc tgatgctggc cactaacgat ccgcccgcca actgggccaa ggctggtttc 420 caggaggata cccggtttgc cgcctttgac ttcttcgatg ccgtcgattc cactgccgcg 480 ctggagcctg ctgaatggca gcgccgccct actgaccgag aacgtgctgc gcactcgatc 540 gggaagtacg gcgcccttgc ccgtcagcgt atccaaaacg gcaacctcat caccaacatt 600 gccgaggtca ccaagggcca tcttggctcc accaacaccc tctat 645 //