ID AJ972376; SV 1; linear; genomic RNA; STD; VRL; 957 BP. XX AC AJ972376; XX DT 16-JUN-2005 (Rel. 84, Created) DT 16-JUN-2005 (Rel. 84, Last updated, Version 1) XX DE Daphne virus S CP gene for coat protein, genomic RNA, isolate Kr3 XX KW coat protein; CP gene. XX OS Daphne virus S OC Viruses; Riboviria; Tymovirales; Betaflexiviridae; Quinvirinae; Carlavirus. XX RN [1] RP 1-957 RA Lee B.; RT ; RL Submitted (25-MAY-2005) to the INSDC. RL Lee B., Division of environmental & life science, University of Seoul RL Women's, Nowongu Gongreung2dong 126, Seoul,139-774, SOUTH KOREA. XX RN [2] RA Lee B., Min B., Ha J., Lee M., Ryu K.; RT "Genome structure and the complete sequence of genome RNA of Daphne virus RT S"; RL Unpublished. XX DR MD5; dd512fa344fea20f494671b2c6ba8084. XX FH Key Location/Qualifiers FH FT source 1..957 FT /organism="Daphne virus S" FT /host="Daphne odora" FT /isolate="Kr3" FT /mol_type="genomic RNA" FT /country="South Korea" FT /db_xref="taxon:216614" FT CDS 1..957 FT /gene="CP" FT /product="coat protein" FT /db_xref="GOA:Q4QZ49" FT /db_xref="InterPro:IPR000052" FT /db_xref="InterPro:IPR013569" FT /db_xref="UniProtKB/TrEMBL:Q4QZ49" FT /protein_id="CAI99157.1" FT /translation="MPPKPDPQSSDEQNAEAIVRKMEEERLALERAEAARVAQLPRPTS FT GNQNREHRRAVGVPREGEEERIEQRLDALRQMLRAERGNISVTNASFERGRPALTPTPD FT MRGDASNPYSRPSTDLLWSIKPKPRSDNMATSEDIMRISTQLEGLGVPTEHVSKVILQA FT VFYCADKSSSSYQDPQGTFEFPGGAIMVDDVVGTINSICTLRKVCRLYAAVVWNYMHIH FT DKPPADWRAMGFNYNTRYAAFDFFDYVENEAAIKPAGGIVPRPTDAEYIAFHTYKQLAL FT DRANNNATYANLDVAVTGGRTGPMIERNLNNANNRKQ" XX SQ Sequence 957 BP; 260 A; 230 C; 259 G; 208 T; 0 other; atgcctccaa aaccagaccc acagagttct gacgaacaaa atgctgaagc catagttagg 60 aagatggagg aggagcgact ggctcttgaa cgagcagaag ccgccagagt tgcccaattg 120 cctaggccta ctagtggcaa tcaaaatagg gaacacaggc gtgcagtcgg tgtgcctcgt 180 gagggtgaag aggagcgtat tgagcagaga cttgatgcac taaggcaaat gctgagggct 240 gagaggggga atatctctgt aactaacgcc agctttgaac ggggccggcc tgcgctgact 300 ccaactcctg acatgcgtgg tgatgcgagc aatccttaca gcagaccaag cactgacttg 360 ctctggtcaa tcaagcctaa gccgcggtct gataacatgg ccacgtcaga ggacataatg 420 cgcatttcca cccaacttga ggggctgggt gtgccaacgg agcacgtgag caaagttata 480 ctgcaggccg tgttttattg cgctgacaaa agcagttcca gctatcaaga tccacagggc 540 actttcgaat tccccggtgg ggcaatcatg gtggacgatg tcgtggggac catcaacagc 600 atttgcactc tgcgcaaagt ctgtaggctg tacgccgcag tggtctggaa ttacatgcat 660 atacatgaca aaccaccggc tgattggcgt gcaatgggtt ttaactacaa caccagatat 720 gccgcttttg acttcttcga ctatgttgaa aatgaagctg ccattaagcc tgccggcgga 780 attgtgccta ggcccactga tgcagaatac attgcgttcc atacttacaa gcagcttgcg 840 ctggatagag caaataacaa tgcaacctat gccaatttgg atgttgctgt aactggcgga 900 cgcactgggc ctatgatcga gcgcaatttg aacaatgcca ataatcgtaa gcaatga 957 //