ID AJ971469; SV 1; linear; genomic RNA; STD; VRL; 957 BP. XX AC AJ971469; XX DT 20-JUN-2005 (Rel. 84, Created) DT 20-JUN-2005 (Rel. 84, Last updated, Version 1) XX DE Daphne virus S CP gene for coat protein, genomic RNA, isolate Kr9 XX KW coat protein; CP gene. XX OS Daphne virus S OC Viruses; Riboviria; Tymovirales; Betaflexiviridae; Quinvirinae; Carlavirus. XX RN [1] RP 1-957 RA Lee B.; RT ; RL Submitted (19-MAY-2005) to the INSDC. RL Lee B., Division of Environmental & Life Science, Seoul Women's University, RL Nowongu Gongreung 2dong 126, Seoul, 139-774, SOUTH KOREA. XX RN [2] RA Lee B., Min B., Ha J., Lee M., Ryu K.; RT "Genome structure and the complete sequence of genome RNA of Daphne virus RT S"; RL Unpublished. XX DR MD5; bae963d0a7c5391361045bebbebd4ddb. XX FH Key Location/Qualifiers FH FT source 1..957 FT /organism="Daphne virus S" FT /host="Daphne odora" FT /isolate="Kr9" FT /mol_type="genomic RNA" FT /country="South Korea" FT /db_xref="taxon:216614" FT CDS 1..957 FT /gene="CP" FT /product="coat protein" FT /db_xref="GOA:Q5GR19" FT /db_xref="InterPro:IPR000052" FT /db_xref="InterPro:IPR013569" FT /db_xref="UniProtKB/TrEMBL:Q5GR19" FT /protein_id="CAI96552.1" FT /translation="MPPKPDPQSSEEQNAAAIAKALEEERLALERAEAARAAQLPRPAS FT GNQNRDHRRAVGVPREGEDERIEQRLDALRQMLRAERGNISVTNASFERGRPALTPTPD FT MRGDPSNPYSRPSTDLLWSIKPKPRSDNMATSEDIMRISTQLEGLGVPTEHVSKVILQA FT VFYCADKSSSSYQDPQGTFEFPGGAIMVDDVVGTINSICTLRKVCRLYAAVVWNYMHIH FT DKPPADWRAMGFNYNTRYAAFDFFDYVENEAAIKPAGGIVPRPTDAEYIAFHTYKQLAL FT DRANNNATYANLDVAVTGGRTGPLIERNLNNANNRKQ" XX SQ Sequence 957 BP; 262 A; 229 C; 255 G; 211 T; 0 other; atgcctccaa aaccagaccc gcaaagttca gaggagcaaa atgctgccgc tattgctaaa 60 gctctcgaag aagaaaggct tgccctagag cgagctgaag cagccagggc agcgcagcta 120 cctaggccag ctagcggaaa tcagaataga gaccataggc gtgccgtggg tgtaccacgt 180 gagggtgagg atgagcgcat agagcaaagg cttgatgcac taaggcaaat gctgagggct 240 gaaaggggca atatttctgt aaccaatgct agttttgaac gagggcgtcc tgccctcacg 300 cccactccgg atatgcgcgg cgatccgagc aacccttata gcagaccaag tactgactta 360 ctatggtcaa taaagccaaa gcctaggtcg gacaacatgg ccacttctga ggacattatg 420 cggatatcta cccagcttga gggtttgggg gtccctactg agcatgtgag caaagttatt 480 ctgcaggctg tcttctactg tgccgacaag agcagctcga gttaccaaga tccacagggg 540 acttttgaat ttccaggagg tgcaatcatg gttgacgatg tcgtgggaac tatcaatagc 600 atctgcaccc tgaggaaggt ctgtaggctg tatgctgccg tggtttggaa ttacatgcac 660 attcatgata aaccacctgc tgactggaga gctatgggtt tcaactataa cacccgatat 720 gcggcctttg acttcttcga ctacgtcgag aacgaagctg caatcaagcc tgcaggtgga 780 atcgtgccta ggcccacaga tgctgaatat attgcattcc acacttacaa gcagctcgct 840 ctggatcggg ctaacaacaa tgcgacttat gccaacttag atgtagcagt gactgggggg 900 cgcaccgggc ctttgatcga acgtaattta aataatgcca ataatcgtaa gcaatga 957 //