ID AJ885169; SV 1; linear; mRNA; STD; VRL; 720 BP. XX AC AJ885169; XX DT 23-JUN-2005 (Rel. 84, Created) DT 23-JUN-2005 (Rel. 84, Last updated, Version 1) XX DE Rice yellow mottle virus mRNA for coat protein (ORF4 gene), isolate To9 XX KW coat protein; cp gene; ORF4. XX OS Rice yellow mottle virus OC Viruses; Riboviria; Solemoviridae; Sobemovirus. XX RN [1] RP 1-720 RA Fargette D.; RT ; RL Submitted (17-FEB-2005) to the INSDC. RL Fargette D., Dgpc, Ird, BP64501, 34394 Montpellier cedex 5, FRANCE. XX RN [2] RX DOI; 10.1111/j.1365-294X.2005.02578.x. RX PUBMED; 15910330. RA Traore O., Sorho F., Pinel A., Abubakar Z.; RT "Processes of diversification and dispersion of rice yellow mottle virus RT inferred from large-scale and high-resolution phylogeographical studies"; RL Mol. Ecol. 14(7):2097-2110(0). XX RN [3] RX DOI; 10.1111/j.1365-294X.2005.02578.x. RX PUBMED; 15910330. RA Traore O., Sorho F., Pinel A., Abubakar Z., Banwo O., Maley J., Hebrard E., RA Winter S., Sere Y., Konate G., Fargette D.; RT "Processes of diversification and dispersion of rice yellow mottle virus RT inferred from large-scale and high-resolution phylogeographical studies"; RL Mol. Ecol. 14(7):2097-2110(2005). XX DR MD5; fe687c13f90d0b5c96dd3345ea26348b. XX FH Key Location/Qualifiers FH FT source 1..720 FT /organism="Rice yellow mottle virus" FT /isolate="To9" FT /mol_type="mRNA" FT /country="Togo" FT /db_xref="taxon:31744" FT CDS 1..720 FT /product="coat protein" FT /note="ORF4" FT /db_xref="GOA:Q4QZK3" FT /db_xref="InterPro:IPR000937" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:Q4QZK3" FT /experiment="experimental evidence, no additional details FT recorded" FT /protein_id="CAI59716.1" FT /translation="MARKGKKTNSNQGQQGKKKSRRPRGRSAEPQLQRAPVAQASRISG FT MVPGPLSSNTWPLHSVEFLADFKRSSTSADATTYNCVPFNLPRVWSLARCYSMWKPTRW FT DVVYLPEVSATVAGSIEMCFLYDYADTIPSDTGKMSRTAGFVTSSVWYGAEGCHLLSGG FT SARNAVVASMDCSRVGWKRVTSSIPSSVDPNVVNTILPARLAVRSSIKPTVDDTPGKLY FT AIVSMVLRDPVDPTLNT" XX SQ Sequence 720 BP; 158 A; 193 C; 210 G; 159 T; 0 other; atggccagga agggcaagaa aaccaactcc aaccaggggc agcaaggaaa gaagaagagc 60 cgacgcccgc gtgggcgttc ggcggagccc cagcttcaac gggctccagt ggctcaggcc 120 tcccggatat ctgggatggt tcctggtcca ctatcctcta acacctggcc gctccactcc 180 gttgagttcc ttgcggactt caagcggagt tccacatcgg cggatgcgac gacatacaat 240 tgtgtgccat ttaatctgcc tcgggtgtgg agtcttgcac gttgttactc gatgtggaag 300 ccaacacggt gggatgttgt ctacctcccg gaggttagtg caacagttgc tgggagtatc 360 gagatgtgtt ttctctacga ctatgctgac acaatcccaa gtgacacggg caagatgagc 420 aggacggcgg gcttcgtcac ctccagcgtt tggtacggcg cggagggctg ccacttatta 480 agtggtggct cagcacgaaa tgccgtggtc gcctcgatgg actgttctcg agtcggctgg 540 aaacgcgtta ctagttctat tcctagtagc gtggatccca acgtcgtaaa caccatactg 600 ccagcaaggc tagctgtgcg atcgtcgatc aaaccgacgg ttgacgatac gccggggaaa 660 ctctatgcta tcgttagtat ggtcctgcgg gacccggttg atccaacact caatacgtga 720 //