ID AJ885160; SV 1; linear; mRNA; STD; VRL; 720 BP. XX AC AJ885160; XX DT 23-JUN-2005 (Rel. 84, Created) DT 23-JUN-2005 (Rel. 84, Last updated, Version 1) XX DE Rice yellow mottle virus mRNA for coat protein (ORF4 gene), isolate Tz19 XX KW coat protein; cp gene; ORF4. XX OS Rice yellow mottle virus OC Viruses; Riboviria; Solemoviridae; Sobemovirus. XX RN [1] RP 1-720 RA Fargette D.; RT ; RL Submitted (17-FEB-2005) to the INSDC. RL Fargette D., Dgpc, Ird, BP64501, 34394 Montpellier cedex 5, FRANCE. XX RN [2] RX DOI; 10.1111/j.1365-294X.2005.02578.x. RX PUBMED; 15910330. RA Traore O., Sorho F., Pinel A., Abubakar Z.; RT "Processes of diversification and dispersion of rice yellow mottle virus RT inferred from large-scale and high-resolution phylogeographical studies"; RL Mol. Ecol. 14(7):2097-2110(0). XX RN [3] RX DOI; 10.1111/j.1365-294X.2005.02578.x. RX PUBMED; 15910330. RA Traore O., Sorho F., Pinel A., Abubakar Z., Banwo O., Maley J., Hebrard E., RA Winter S., Sere Y., Konate G., Fargette D.; RT "Processes of diversification and dispersion of rice yellow mottle virus RT inferred from large-scale and high-resolution phylogeographical studies"; RL Mol. Ecol. 14(7):2097-2110(2005). XX DR MD5; f16f1bbef7dd0d2ebcc3381091f58618. XX FH Key Location/Qualifiers FH FT source 1..720 FT /organism="Rice yellow mottle virus" FT /isolate="Tz19" FT /mol_type="mRNA" FT /country="Tanzania" FT /db_xref="taxon:31744" FT CDS 1..720 FT /product="coat protein" FT /note="ORF4" FT /db_xref="GOA:Q4QZK9" FT /db_xref="InterPro:IPR000937" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:Q4QZK9" FT /experiment="experimental evidence, no additional details FT recorded" FT /protein_id="CAI59707.1" FT /translation="MARKGKKTNSNQNQQGKKSRRPRGRSAEPRLQRAPVAQASRISGM FT VPGPLSSNVWPVNRSVEFLMDFKRSATSADATIFNCVPFNLPRVWTLARCYSLWKPTRW FT DVVYLPEVSAATAGSIEMCYLYDYADTIPSDTGKMSRTAGFVTSSVWYGAEGCHLLTGG FT SARNAVVASMDCSRVDWKRVTSSIPSGVDPNVVNTILPARLAVRSSIKPAVDDAPGKLY FT AIVSMVLRDPVDPTLNT" XX SQ Sequence 720 BP; 155 A; 196 C; 208 G; 161 T; 0 other; atggccagga agggcaagaa aaccaactcc aaccaaaacc agcaaggcaa gaagagccgg 60 cgcccccgtg ggcgttcggc ggaaccccgg cttcaacggg ctccagtggc tcaggcctcc 120 cggatatctg ggatggttcc tggtccacta tcttctaacg tctggccggt taaccgctcc 180 gtggaattcc tgatggattt caaacggagc gccacctcgg cagatgcgac catattcaac 240 tgtgtgccgt tcaatctgcc ccgagtgtgg actcttgcgc gttgttactc cttgtggaag 300 ccaacaaggt gggatgttgt ctacctccct gaggttagtg cagcgacggc tggaagtatc 360 gagatgtgct atctctacga ctatgccgac acaatcccaa gtgacacggg taagatgagt 420 aggacggcgg gcttcgtcac ctctagcgtt tggtacggcg cggagggctg ccatttgtta 480 actggtggct cagcacggaa tgccgtggtc gcctcgatgg attgttctcg agtcgactgg 540 aaacgcgtta ctagttcaat tcctagtggc gtggatccca acgtcgtaaa caccatactg 600 ccagctaggc tagctgtgcg gtcgtcgatt aaaccggcgg ttgatgatgc accaggcaag 660 ctgtatgcca tcgtcagtat ggtcctgcgg gatccggttg acccaacact caatacgtga 720 //