ID AJ885157; SV 1; linear; mRNA; STD; VRL; 720 BP. XX AC AJ885157; XX DT 23-JUN-2005 (Rel. 84, Created) DT 23-JUN-2005 (Rel. 84, Last updated, Version 1) XX DE Rice yellow mottle virus mRNA for coat protein (ORF4 gene), isolate Tz16 XX KW coat protein; cp gene; ORF4. XX OS Rice yellow mottle virus OC Viruses; Riboviria; Solemoviridae; Sobemovirus. XX RN [1] RP 1-720 RA Fargette D.; RT ; RL Submitted (17-FEB-2005) to the INSDC. RL Fargette D., Dgpc, Ird, BP64501, 34394 Montpellier cedex 5, FRANCE. XX RN [2] RX DOI; 10.1111/j.1365-294X.2005.02578.x. RX PUBMED; 15910330. RA Traore O., Sorho F., Pinel A., Abubakar Z.; RT "Processes of diversification and dispersion of rice yellow mottle virus RT inferred from large-scale and high-resolution phylogeographical studies"; RL Mol. Ecol. 14(7):2097-2110(0). XX RN [3] RX DOI; 10.1111/j.1365-294X.2005.02578.x. RX PUBMED; 15910330. RA Traore O., Sorho F., Pinel A., Abubakar Z., Banwo O., Maley J., Hebrard E., RA Winter S., Sere Y., Konate G., Fargette D.; RT "Processes of diversification and dispersion of rice yellow mottle virus RT inferred from large-scale and high-resolution phylogeographical studies"; RL Mol. Ecol. 14(7):2097-2110(2005). XX DR MD5; f18e77933ed39e03d334335d7f04c810. XX FH Key Location/Qualifiers FH FT source 1..720 FT /organism="Rice yellow mottle virus" FT /isolate="Tz16" FT /mol_type="mRNA" FT /country="Tanzania" FT /db_xref="taxon:31744" FT CDS 1..720 FT /product="coat protein" FT /note="ORF4" FT /db_xref="GOA:Q4QZL2" FT /db_xref="InterPro:IPR000937" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:Q4QZL2" FT /experiment="experimental evidence, no additional details FT recorded" FT /protein_id="CAI59704.1" FT /translation="MARKGKKTNSNQNQQGKKSRRPRGRSAEPRLQRAPVAQASRISGT FT VPGPLSSNVWPINRSVEFLMDFKRSATSTEATILNCVPFNLPRVWSLARCYSLWKPTRW FT DVVYLPEISAAAAGSIEMCYLYDYADTVPNDTGKMSRTAGFVTSSVWYGAEGCHLLTGG FT SARNAVVASMDCSRVDWKRVTSSIPSGVDPNVVNTILPARLAVRSSIKPAVDDTPGKLY FT AIVSMVLRDPVDPTLNT" XX SQ Sequence 720 BP; 163 A; 195 C; 203 G; 159 T; 0 other; atggccagga agggcaagaa aaccaactcc aaccaaaatc agcaaggcaa gaagagccgc 60 cgccctcgtg ggcggtcggc ggaaccccgg cttcaacggg ctccagtggc tcaggcctcc 120 cggatatctg ggacggttcc tggaccacta tcttctaatg tctggccgat taaccgctcc 180 gtggaattct tgatggattt caagcggagc gccacctcga cagaggcgac catacttaat 240 tgtgtgccgt tcaatctgcc tcgagtgtgg agtcttgcac gttgctactc cttgtggaag 300 ccaacaaggt gggacgtcgt ctatctccct gagattagcg cggcagcagc tggaagtatc 360 gagatgtgtt atctctacga ctatgctgac acggtcccaa atgacacggg caagatgagc 420 aggacagcgg gcttcgtcac ctccagcgtt tggtacggcg cggagggctg ccatttgtta 480 actggcggct cagcacgaaa tgccgtggtt gcctcgatgg attgttcccg agtcgactgg 540 aaacgcgtta ctagttcaat ccctagtggc gtggatccca acgttgtaaa caccatactg 600 ccagctaggc tagctgtgcg gtcgtcgatt aaaccggcgg ttgatgatac accaggtaaa 660 ctgtacgcta tcgtcagtat ggtcctgcgg gacccagttg atccaacact caatacgtga 720 //