ID AJ885147; SV 1; linear; mRNA; STD; VRL; 720 BP. XX AC AJ885147; XX DT 23-JUN-2005 (Rel. 84, Created) DT 23-JUN-2005 (Rel. 84, Last updated, Version 1) XX DE Rice yellow mottle virus mRNA for coat protein (ORF4 gene), isolate Ng3 XX KW coat protein; cp gene; ORF4. XX OS Rice yellow mottle virus OC Viruses; Riboviria; Solemoviridae; Sobemovirus. XX RN [1] RP 1-720 RA Fargette D.; RT ; RL Submitted (17-FEB-2005) to the INSDC. RL Fargette D., Dgpc, Ird, BP64501, 34394 Montpellier cedex 5, FRANCE. XX RN [2] RX DOI; 10.1111/j.1365-294X.2005.02578.x. RX PUBMED; 15910330. RA Traore O., Sorho F., Pinel A., Abubakar Z.; RT "Processes of diversification and dispersion of rice yellow mottle virus RT inferred from large-scale and high-resolution phylogeographical studies"; RL Mol. Ecol. 14(7):2097-2110(0). XX RN [3] RX DOI; 10.1111/j.1365-294X.2005.02578.x. RX PUBMED; 15910330. RA Traore O., Sorho F., Pinel A., Abubakar Z., Banwo O., Maley J., Hebrard E., RA Winter S., Sere Y., Konate G., Fargette D.; RT "Processes of diversification and dispersion of rice yellow mottle virus RT inferred from large-scale and high-resolution phylogeographical studies"; RL Mol. Ecol. 14(7):2097-2110(2005). XX DR MD5; 9a73cf3879b9b50753e9d138bb9c8e33. XX FH Key Location/Qualifiers FH FT source 1..720 FT /organism="Rice yellow mottle virus" FT /isolate="Ng3" FT /mol_type="mRNA" FT /country="Niger" FT /db_xref="taxon:31744" FT CDS 1..720 FT /product="coat protein" FT /note="ORF4" FT /db_xref="GOA:Q4QZJ7" FT /db_xref="InterPro:IPR000937" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:Q4QZJ7" FT /experiment="experimental evidence, no additional details FT recorded" FT /protein_id="CAI59694.1" FT /translation="MGRKGKKTNSNQGQQGKKKSRRPRGRSAEPQLQRAPVAQASRISG FT MVPGPLSSNTWPLHSVEFLADFKRSSTSADATTYNCVPFNLPRVWSLARCYSMWKPTRW FT DVVYLPEVSATVAGSIEMCFLYDYADTIPSDTGKMSRTAGFVTSSVWYGAEGCHLLSGG FT SARNAVVASMDCSRVGWKRVTSSIPSSVDPNVVNTILPARLAVRSSIKPTVDDTPGKLY FT AIVSMVLRDPVDPTLNT" XX SQ Sequence 720 BP; 155 A; 195 C; 213 G; 157 T; 0 other; atgggcagga agggcaagaa aaccaactcc aaccaggggc agcaaggaaa gaagaagagc 60 cgacgcccgc gtggtcgttc ggcggagccc cagcttcaac gggctccagt ggctcaggcc 120 tcccggatat ctgggatggt tcctggtcca ctatcttcta acacctggcc gctccactcc 180 gttgagttcc ttgcggactt caagcggagt tccacatcgg cggacgcgac gacatacaat 240 tgtgtgccgt ttaatttgcc tcgggtgtgg agtcttgcac gttgttactc gatgtggaag 300 ccaacacggt gggatgtcgt ctacctcccg gaggttagtg cgacggttgc tgggagtatc 360 gagatgtgtt ttctctacga ctatgctgac acaatcccaa gtgacacggg caagatgagc 420 aggacggcgg gcttcgtcac ctccagcgtt tggtacggcg cggagggctg ccacttatta 480 agtggtggct cagcacgaaa tgccgtggtc gcctcgatgg actgttctcg agtcggctgg 540 aaacgcgtta ctagttctat tcctagcagc gtggatccca acgtcgtaaa caccatactg 600 ccagcaaggc tagctgtgcg atcgtcgatc aaaccgacgg ttgacgatac gccggggaaa 660 ctctacgcta tcgtcagtat ggtcctgcgg gacccggttg atccaacact caatacgtga 720 //