ID AJ885141; SV 1; linear; mRNA; STD; VRL; 720 BP. XX AC AJ885141; XX DT 23-JUN-2005 (Rel. 84, Created) DT 23-JUN-2005 (Rel. 84, Last updated, Version 1) XX DE Rice yellow mottle virus mRNA for coat protein (ORF4 gene), isolate Ma171 XX KW coat protein; cp gene; ORF4. XX OS Rice yellow mottle virus OC Viruses; Riboviria; Solemoviridae; Sobemovirus. XX RN [1] RP 1-720 RA Fargette D.; RT ; RL Submitted (17-FEB-2005) to the INSDC. RL Fargette D., Dgpc, Ird, BP64501, 34394 Montpellier cedex 5, FRANCE. XX RN [2] RX DOI; 10.1111/j.1365-294X.2005.02578.x. RX PUBMED; 15910330. RA Traore O., Sorho F., Pinel A., Abubakar Z.; RT "Processes of diversification and dispersion of rice yellow mottle virus RT inferred from large-scale and high-resolution phylogeographical studies"; RL Mol. Ecol. 14(7):2097-2110(0). XX RN [3] RX DOI; 10.1111/j.1365-294X.2005.02578.x. RX PUBMED; 15910330. RA Traore O., Sorho F., Pinel A., Abubakar Z., Banwo O., Maley J., Hebrard E., RA Winter S., Sere Y., Konate G., Fargette D.; RT "Processes of diversification and dispersion of rice yellow mottle virus RT inferred from large-scale and high-resolution phylogeographical studies"; RL Mol. Ecol. 14(7):2097-2110(2005). XX DR MD5; 31dc3ebcc850cc2cc28c52e7f89ef308. XX FH Key Location/Qualifiers FH FT source 1..720 FT /organism="Rice yellow mottle virus" FT /isolate="Ma171" FT /mol_type="mRNA" FT /country="Mali" FT /db_xref="taxon:31744" FT CDS 1..720 FT /product="coat protein" FT /note="ORF4" FT /db_xref="GOA:Q4QZM8" FT /db_xref="InterPro:IPR000937" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:Q4QZM8" FT /experiment="experimental evidence, no additional details FT recorded" FT /protein_id="CAI59688.1" FT /translation="MARKGKKTNSNQGQQGKKKSRRPRGRSAEPQLQRAPVAQASRISG FT TVPGPLSSNTWPLHSVEFLADFKRSATSADATTYNCVPFNLPRVWSLARCYSVWKPTRW FT DVVYLPEVSAAAAGSIEMCYLYDYADTIPSDTGKMSRTAGFVTSSVWYGAEGCHLLSGG FT SARNAVVASMDCSRVGRKRVTSSIPSDADPNVVNTILPARLAVRSSIKPTVDDMPGKLY FT AIVSMVLRDPVDPTLNT" XX SQ Sequence 720 BP; 150 A; 202 C; 218 G; 150 T; 0 other; atggccagga agggcaagaa aaccaactcc aaccaggggc agcaagggaa gaagaagagc 60 cgacgccctc gtgggcgttc ggcggagccc cagcttcaac gggctccagt ggctcaggcc 120 tcccggatat ctgggacggt tcctggtcca ctatcttcta acacctggcc gctccactcc 180 gtggaattcc tcgcggattt taagcggagt gccacctcgg cggacgcgac gacatacaat 240 tgtgtgccgt ttaatctgcc tcgagtgtgg agtcttgcgc gttgttactc tgtgtggaag 300 ccaacacggt gggacgtcgt ttacctccca gaggtgagcg cggcggcagc tggaagtatc 360 gagatgtgtt atctctacga ctatgctgac accatcccaa gtgacacggg caagatgagc 420 aggacggcgg gcttcgtcac ctccagcgtt tggtacggcg cggagggctg ccacttgctg 480 agtggtggct cagcacggaa tgctgtggtc gcctcgatgg attgctcccg agtcggccgg 540 aaacgcgtta ctagttctat ccctagcgac gcggatccca acgtcgtaaa caccatactg 600 ccggctaggc tagccgtgcg atcgtcgatt aaaccgacgg ttgatgatat gccggggaaa 660 ctctatgcta tcgtcagtat ggtcctgcgg gacccggttg atccaacact caatacgtga 720 //