ID AJ885137; SV 1; linear; mRNA; STD; VRL; 720 BP. XX AC AJ885137; XX DT 23-JUN-2005 (Rel. 84, Created) DT 23-JUN-2005 (Rel. 84, Last updated, Version 1) XX DE Rice yellow mottle virus mRNA for coat protein (ORF4 gene), isolate Ma145 XX KW coat protein; cp gene; ORF4. XX OS Rice yellow mottle virus OC Viruses; Riboviria; Solemoviridae; Sobemovirus. XX RN [1] RP 1-720 RA Fargette D.; RT ; RL Submitted (17-FEB-2005) to the INSDC. RL Fargette D., Dgpc, Ird, BP64501, 34394 Montpellier cedex 5, FRANCE. XX RN [2] RX DOI; 10.1111/j.1365-294X.2005.02578.x. RX PUBMED; 15910330. RA Traore O., Sorho F., Pinel A., Abubakar Z.; RT "Processes of diversification and dispersion of rice yellow mottle virus RT inferred from large-scale and high-resolution phylogeographical studies"; RL Mol. Ecol. 14(7):2097-2110(0). XX RN [3] RX DOI; 10.1111/j.1365-294X.2005.02578.x. RX PUBMED; 15910330. RA Traore O., Sorho F., Pinel A., Abubakar Z., Banwo O., Maley J., Hebrard E., RA Winter S., Sere Y., Konate G., Fargette D.; RT "Processes of diversification and dispersion of rice yellow mottle virus RT inferred from large-scale and high-resolution phylogeographical studies"; RL Mol. Ecol. 14(7):2097-2110(2005). XX DR MD5; 3e696c1fe862816ba9a929e298216902. XX FH Key Location/Qualifiers FH FT source 1..720 FT /organism="Rice yellow mottle virus" FT /isolate="Ma145" FT /mol_type="mRNA" FT /country="Mali" FT /db_xref="taxon:31744" FT CDS 1..720 FT /product="coat protein" FT /note="ORF4" FT /db_xref="GOA:Q709K1" FT /db_xref="InterPro:IPR000937" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:Q709K1" FT /experiment="experimental evidence, no additional details FT recorded" FT /protein_id="CAI59684.1" FT /translation="MARKGKKINSNQGQQGKKKSRRPRGRSAEPQLQRAPVAQASRISG FT TVPGPLSSNTWPLHSVEFLADFKRSATSADATTYNCVPFNLPRVWSLARCYSMWKPTRW FT DVVYLPEVSAAAAGSIEMCYLYDYADTIPSDTGKMSRTAGFVTSSVWYGAEGCHLLSGG FT SARNAVVASMDCSRVGWKRVTSSIPSGADPNVVNTILPARLAVRSSIKPTADDTPGKLY FT AIVSMVLRDPVDPTLNT" XX SQ Sequence 720 BP; 155 A; 204 C; 214 G; 147 T; 0 other; atggccagga agggcaagaa aatcaactcc aaccaggggc agcaagggaa gaagaagagc 60 cgacgcccac gtgggcgttc ggcggaaccc cagcttcaac gggctccagt ggctcaggcc 120 tcccggatat ctgggacggt tcctggtcca ctatcttcta acacctggcc gctccactcc 180 gtggaattcc tagcggattt taagcggagt gccacctcag cagatgcgac gacatacaac 240 tgtgtgccgt ttaatctgcc ccgagtgtgg agtcttgcgc gttgttactc catgtggaag 300 ccaacacggt gggacgtcgt ttacctccct gaggtgagcg cggcggcagc tggaagtatc 360 gagatgtgtt atctctacga ctacgctgac accatcccaa gtgacacggg caagatgagc 420 aggacggcgg gcttcgtcac ctccagcgtt tggtacggcg cggagggctg ccacttactg 480 agtggcggct cagcacggaa tgccgtggtc gcctcgatgg actgttcccg agtcggctgg 540 aaacgcgtta ctagttctat ccctagtggc gcggatccca acgtcgtaaa caccatactg 600 ccagctaggc tagctgtgcg gtcgtcgatt aaaccgacgg ctgatgatac gccggggaaa 660 ctctacgcta tcgtcagtat ggtcctgcgg gatccggttg atccaacact caatacgtga 720 //