ID AJ885133; SV 1; linear; mRNA; STD; VRL; 720 BP. XX AC AJ885133; XX DT 23-JUN-2005 (Rel. 84, Created) DT 23-JUN-2005 (Rel. 84, Last updated, Version 1) XX DE Rice yellow mottle virus mRNA for coat protein (ORF4 gene), isolate Ma41 XX KW coat protein; cp gene; ORF4. XX OS Rice yellow mottle virus OC Viruses; Riboviria; Solemoviridae; Sobemovirus. XX RN [1] RP 1-720 RA Fargette D.; RT ; RL Submitted (17-FEB-2005) to the INSDC. RL Fargette D., Dgpc, Ird, BP64501, 34394 Montpellier cedex 5, FRANCE. XX RN [2] RX DOI; 10.1111/j.1365-294X.2005.02578.x. RX PUBMED; 15910330. RA Traore O., Sorho F., Pinel A., Abubakar Z.; RT "Processes of diversification and dispersion of rice yellow mottle virus RT inferred from large-scale and high-resolution phylogeographical studies"; RL Mol. Ecol. 14(7):2097-2110(0). XX RN [3] RX DOI; 10.1111/j.1365-294X.2005.02578.x. RX PUBMED; 15910330. RA Traore O., Sorho F., Pinel A., Abubakar Z., Banwo O., Maley J., Hebrard E., RA Winter S., Sere Y., Konate G., Fargette D.; RT "Processes of diversification and dispersion of rice yellow mottle virus RT inferred from large-scale and high-resolution phylogeographical studies"; RL Mol. Ecol. 14(7):2097-2110(2005). XX DR MD5; da6527ebb36a6e3f6c052fb555031421. XX FH Key Location/Qualifiers FH FT source 1..720 FT /organism="Rice yellow mottle virus" FT /isolate="Ma41" FT /mol_type="mRNA" FT /country="Mali" FT /db_xref="taxon:31744" FT CDS 1..720 FT /product="coat protein" FT /note="ORF4" FT /db_xref="GOA:Q4QZN6" FT /db_xref="InterPro:IPR000937" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:Q4QZN6" FT /experiment="experimental evidence, no additional details FT recorded" FT /protein_id="CAI59680.1" FT /translation="MARKGKKINSNQGQQGKKKSRRPRGRSVEPQLQRAPVAQASRISG FT TVPGPLSSNTWPLHSVEFLADFKRSSTSADATTYDCVPFNLPRVWSLARCYSMWKPTRW FT DVVYLPEVSATVAGSIEMCFLYDYADTIPSDTGKMSRTAGFVTSSVWYGAEGCHLLSGG FT SARNAVVASMDCSRVGWKRVTSSIPSSVDPNVVNTILPARLAVRSSIKPTVSDTPGKLY FT VIASMVLRDPVDPTLNT" XX SQ Sequence 720 BP; 152 A; 192 C; 212 G; 164 T; 0 other; atggccagga agggcaagaa aatcaactcc aaccaggggc agcaaggaaa gaagaagagc 60 cgtcgccctc gtgggcgttc ggtggagcct cagcttcaac gggctccggt ggctcaggcc 120 tcccggatat ctgggacggt tcctggtcca ctatcttcta atacctggcc gctccactcc 180 gtggaattcc ttgcggattt taagcggagt tccacatccg cggatgcgac gacatacgat 240 tgtgtgccgt ttaatctgcc tcgggtgtgg agtcttgcac gttgttactc catgtggaag 300 ccaacacggt gggatgtcgt ttacctccct gaggtgagcg caacggtcgc tgggagtatt 360 gagatgtgtt ttctctacga ctatgctgac actatcccaa gtgacacggg caagatgagc 420 aggacggcgg gcttcgtcac ctctagcgtt tggtacggcg cggagggctg ccatttactc 480 agtggtggct cagcacgaaa tgccgtggtc gcctcgatgg actgttcccg agtcggctgg 540 aaacgcgtta ctagttccat acctagtagc gtggatccca acgtcgtaaa caccatactg 600 ccggctaggc tagccgtgcg atcgtcgatc aaaccgacgg ttagtgatac gccggggaaa 660 ctctacgtaa tcgctagtat ggtcctgcgg gatccggttg atccaacact caatacgtga 720 //