ID AJ885128; SV 1; linear; mRNA; STD; VRL; 720 BP. XX AC AJ885128; XX DT 23-JUN-2005 (Rel. 84, Created) DT 23-JUN-2005 (Rel. 84, Last updated, Version 1) XX DE Rice yellow mottle virus mRNA for coat protein (ORF4 gene), isolate Ke2 XX KW coat protein; cp gene; ORF4. XX OS Rice yellow mottle virus OC Viruses; Riboviria; Solemoviridae; Sobemovirus. XX RN [1] RP 1-720 RA Fargette D.; RT ; RL Submitted (17-FEB-2005) to the INSDC. RL Fargette D., Dgpc, Ird, BP64501, 34394 Montpellier cedex 5, FRANCE. XX RN [2] RX DOI; 10.1111/j.1365-294X.2005.02578.x. RX PUBMED; 15910330. RA Traore O., Sorho F., Pinel A., Abubakar Z.; RT "Processes of diversification and dispersion of rice yellow mottle virus RT inferred from large-scale and high-resolution phylogeographical studies"; RL Mol. Ecol. 14(7):2097-2110(0). XX RN [3] RX DOI; 10.1111/j.1365-294X.2005.02578.x. RX PUBMED; 15910330. RA Traore O., Sorho F., Pinel A., Abubakar Z., Banwo O., Maley J., Hebrard E., RA Winter S., Sere Y., Konate G., Fargette D.; RT "Processes of diversification and dispersion of rice yellow mottle virus RT inferred from large-scale and high-resolution phylogeographical studies"; RL Mol. Ecol. 14(7):2097-2110(2005). XX DR MD5; 6290420878498a83f8d2d116f222a7bf. XX FH Key Location/Qualifiers FH FT source 1..720 FT /organism="Rice yellow mottle virus" FT /isolate="Ke2" FT /mol_type="mRNA" FT /country="Kenya" FT /db_xref="taxon:31744" FT CDS 1..720 FT /product="coat protein" FT /note="ORF4" FT /db_xref="GOA:Q4QZP1" FT /db_xref="InterPro:IPR000937" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:Q4QZP1" FT /experiment="experimental evidence, no additional details FT recorded" FT /protein_id="CAI59675.1" FT /translation="MARKGKKTNSNQGQQGKKKSRRPRGRSAEPQLQRAPVAQASRISG FT TVPGPLSSNSWPVHSVEFLMDFKRSATSAEATTFNCVPFNLPRVWSFARCYSLWKPTRW FT DVIYLPEVSAATAGSIEMCYLYDYADAIPSDTGKMSRTAGFVTSSVWYGAEGCHLLSGG FT TARNAVVASMDCSRVGWRRVTGSIPSSVDPNVVNTILPARLAVRSSIKPTVDDVPGKLY FT AIVSMVLRDPVDPTLNT" XX SQ Sequence 720 BP; 155 A; 197 C; 215 G; 153 T; 0 other; atggccagga agggcaagaa aaccaactcc aaccagggcc agcaaggaaa gaagaagagc 60 cggcgtcccc gtgggcgttc ggcggagccc cagcttcaac gggctccagt ggctcaggcc 120 tcccggatat ctgggacggt tcctggtcca ctatcttcta actcctggcc ggtccactcc 180 gtggaattcc taatggattt taagcggagt gccacatcgg cggaagcgac gacattcaac 240 tgtgtgccgt tcaatctgcc tcgggtgtgg agttttgcgc gttgttactc actgtggaag 300 ccaacacggt gggatgtcat ctacctccct gaggttagtg cggcaacagc tggaagtatt 360 gagatgtgct atctctacga ctatgctgac gccatcccaa gtgacacggg caagatgagc 420 aggacggcgg gcttcgtcac ctctagcgtt tggtacggcg ctgagggctg ccacttgttg 480 agtggcggca cagcacgaaa tgccgtggtc gcctcgatgg attgctcccg agtcggctgg 540 agacgcgtta ctggttcaat acccagcagc gtggatccca acgtcgtaaa caccatactg 600 ccagcaaggc tagctgtgcg gtcgtcaatt aagccgacgg ttgatgatgt gccggggaaa 660 ctctacgcca tcgtcagtat ggtcctgcgg gatccggttg atccaacact caatacgtga 720 //