ID AJ885107; SV 1; linear; mRNA; STD; VRL; 720 BP. XX AC AJ885107; XX DT 23-JUN-2005 (Rel. 84, Created) DT 23-JUN-2005 (Rel. 84, Last updated, Version 1) XX DE Rice yellow mottle virus mRNA for coat protein (ORF4 gene), isolate CI113 XX KW coat protein; cp gene; ORF4. XX OS Rice yellow mottle virus OC Viruses; Riboviria; Solemoviridae; Sobemovirus. XX RN [1] RP 1-720 RA Fargette D.; RT ; RL Submitted (17-FEB-2005) to the INSDC. RL Fargette D., Dgpc, Ird, BP64501, 34394 Montpellier cedex 5, FRANCE. XX RN [2] RX DOI; 10.1111/j.1365-294X.2005.02578.x. RX PUBMED; 15910330. RA Traore O., Sorho F., Pinel A., Abubakar Z.; RT "Processes of diversification and dispersion of rice yellow mottle virus RT inferred from large-scale and high-resolution phylogeographical studies"; RL Mol. Ecol. 14(7):2097-2110(0). XX RN [3] RX DOI; 10.1111/j.1365-294X.2005.02578.x. RX PUBMED; 15910330. RA Traore O., Sorho F., Pinel A., Abubakar Z., Banwo O., Maley J., Hebrard E., RA Winter S., Sere Y., Konate G., Fargette D.; RT "Processes of diversification and dispersion of rice yellow mottle virus RT inferred from large-scale and high-resolution phylogeographical studies"; RL Mol. Ecol. 14(7):2097-2110(2005). XX DR MD5; e37322ac02698da7b5b9ffe351c430ab. XX FH Key Location/Qualifiers FH FT source 1..720 FT /organism="Rice yellow mottle virus" FT /isolate="CI113" FT /mol_type="mRNA" FT /country="Cote d'Ivoire" FT /db_xref="taxon:31744" FT CDS 1..720 FT /product="coat protein" FT /note="ORF4" FT /db_xref="GOA:Q9DGY6" FT /db_xref="InterPro:IPR000937" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:Q9DGY6" FT /experiment="experimental evidence, no additional details FT recorded" FT /protein_id="CAI59654.1" FT /translation="MARKGKKTNSNQGQQGKKKSRRPRGRSAEPQLQRAPVAQASRISG FT TVPGPLSSNTWPLHSVEFLADFKRSATSADATTYDCVPFNLPRVWSLARCYSMWKPTRW FT DVVYLPEVSAAAAGSIEMCFLYDYADTIPSDTGKMSRTAGFVTSSVWYGAEGCHLLSGG FT SARNAVVASMDCSRVGWKRVTSSIPSKTDPNVVNTILPARLAVRSSIKPTVDDTPGKLY FT AIVSMVLRDPVDPTLNT" XX SQ Sequence 720 BP; 157 A; 198 C; 212 G; 153 T; 0 other; atggccagga agggcaagaa aaccaactcc aaccaggggc agcaaggaaa gaagaagagt 60 cggcgcccac gtgggcgttc ggcggagcct cagcttcaac gggctccggt ggctcaggcc 120 tcccggatat ctgggacggt tcctggtcca ctatcttcta acacctggcc gctccactcc 180 gtggaattcc tagcggattt taagcggagt gccacctcag cagacgcgac gacatatgat 240 tgtgtgccgt tcaatctgcc tcgagtgtgg agtcttgcgc gttgttactc catgtggaag 300 ccaacacggt gggatgtcgt ttacctccct gaggtgagcg cggcggcagc tggaagtatc 360 gagatgtgtt ttctctacga ctatgctgac accatcccaa gtgacacggg caagatgagc 420 aggacggcgg gcttcgtcac ctccagcgtt tggtacggcg cggagggctg ccacttacta 480 agtggcggct cagcacgaaa tgccgtggtc gcctcgatgg attgctcccg agtcggctgg 540 aaacgtgtta ctagttccat tcctagtaaa acggatccca acgtcgtaaa caccatactg 600 ccagctaggc tagctgtgcg gtcgtcgatc aaaccgacgg ttgatgatac gccggggaaa 660 ctctacgcta tcgtcagtat ggtcctgcgg gatccggttg atccaacact caatacgtga 720 //