ID AJ885093; SV 1; linear; mRNA; STD; VRL; 720 BP. XX AC AJ885093; XX DT 23-JUN-2005 (Rel. 84, Created) DT 23-JUN-2005 (Rel. 84, Last updated, Version 1) XX DE Rice yellow mottle virus mRNA for coat protein (ORF4 gene), isolate BF682 XX KW coat protein; cp gene; ORF4. XX OS Rice yellow mottle virus OC Viruses; Riboviria; Solemoviridae; Sobemovirus. XX RN [1] RP 1-720 RA Fargette D.; RT ; RL Submitted (17-FEB-2005) to the INSDC. RL Fargette D., Dgpc, Ird, BP64501, 34394 Montpellier cedex 5, FRANCE. XX RN [2] RX DOI; 10.1111/j.1365-294X.2005.02578.x. RX PUBMED; 15910330. RA Traore O., Sorho F., Pinel A., Abubakar Z.; RT "Processes of diversification and dispersion of rice yellow mottle virus RT inferred from large-scale and high-resolution phylogeographical studies"; RL Mol. Ecol. 14(7):2097-2110(0). XX RN [3] RX DOI; 10.1111/j.1365-294X.2005.02578.x. RX PUBMED; 15910330. RA Traore O., Sorho F., Pinel A., Abubakar Z., Banwo O., Maley J., Hebrard E., RA Winter S., Sere Y., Konate G., Fargette D.; RT "Processes of diversification and dispersion of rice yellow mottle virus RT inferred from large-scale and high-resolution phylogeographical studies"; RL Mol. Ecol. 14(7):2097-2110(2005). XX DR MD5; 5e79b24817d2e958ff5d9cf17042a2b4. XX FH Key Location/Qualifiers FH FT source 1..720 FT /organism="Rice yellow mottle virus" FT /isolate="BF682" FT /mol_type="mRNA" FT /country="Burkina Faso" FT /db_xref="taxon:31744" FT CDS 1..720 FT /product="coat protein" FT /note="ORF4" FT /db_xref="GOA:Q4QZS6" FT /db_xref="InterPro:IPR000937" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:Q4QZS6" FT /experiment="experimental evidence, no additional details FT recorded" FT /protein_id="CAI59640.1" FT /translation="MARKGKKVNSNQGQQGKRKSRRPRGRSAEPQLQRAPVAQASRISG FT TVPGPLSSNTWPLHSVEFLADFKRSSTSADATTYDCVPFNLPRVWSLARCYSMWKPTRW FT DVVYLPEVSATVAGSIEMCFLYDYADTIPSDTGKMSRTAGFVTSSVWYGAEGCHLLSGG FT SARNAVVASMDCSRVGWKRVTSSIPSSVDPNVVNTILPARLAVRSSIKPTVSDTPGKLY FT VIASMVLRDPVDPTLNT" XX SQ Sequence 720 BP; 153 A; 199 C; 213 G; 155 T; 0 other; atggccagga agggcaagaa agtcaactcc aaccaggggc agcaaggaaa gcggaagagc 60 cggcgtccac gtggacgatc ggcggagccc cagcttcaac gggctccagt ggctcaggcc 120 tcccggatat ctgggacggt tcctggtcca ctatcttcta acacctggcc gctccactcc 180 gttgagttcc tagcggactt caagcggagt tccacatcgg cggatgcgac gacatacgat 240 tgtgtgccgt ttaacctgcc tcgggtgtgg agtcttgctc gttgttactc catgtggaag 300 ccaacacggt gggatgtcgt ttacctccct gaggtgagcg ccacggtagc tggaagtatc 360 gagatgtgtt ttctctacga ctatgctgac accatcccaa gtgacacggg caagatgagc 420 aggacggcgg gcttcgtcac ctctagcgtt tggtacggcg cggagggctg ccacttacta 480 agtggtggct cagcacgaaa tgccgtggtc gcctcgatgg actgttcccg agtcggctgg 540 aaacgcgtta ctagttccat acctagtagc gtggatccca acgtcgtaaa caccatactg 600 ccggctaggc tagccgtgcg atcgtcgatc aaaccgacgg ttagtgatac gccggggaaa 660 ctctacgtta tcgctagtat ggtcctgcgg gatccggttg atccaacact caatacgtga 720 //