ID AJ885090; SV 1; linear; mRNA; STD; VRL; 720 BP. XX AC AJ885090; XX DT 23-JUN-2005 (Rel. 84, Created) DT 23-JUN-2005 (Rel. 84, Last updated, Version 1) XX DE Rice yellow mottle virus mRNA for coat protein (ORF4 gene), isolate BF5 XX KW coat protein; cp gene; ORF4. XX OS Rice yellow mottle virus OC Viruses; Riboviria; Solemoviridae; Sobemovirus. XX RN [1] RP 1-720 RA Fargette D.; RT ; RL Submitted (17-FEB-2005) to the INSDC. RL Fargette D., Dgpc, Ird, BP64501, 34394 Montpellier cedex 5, FRANCE. XX RN [2] RX DOI; 10.1111/j.1365-294X.2005.02578.x. RX PUBMED; 15910330. RA Traore O., Sorho F., Pinel A., Abubakar Z.; RT "Processes of diversification and dispersion of rice yellow mottle virus RT inferred from large-scale and high-resolution phylogeographical studies"; RL Mol. Ecol. 14(7):2097-2110(0). XX RN [3] RX DOI; 10.1111/j.1365-294X.2005.02578.x. RX PUBMED; 15910330. RA Traore O., Sorho F., Pinel A., Abubakar Z., Banwo O., Maley J., Hebrard E., RA Winter S., Sere Y., Konate G., Fargette D.; RT "Processes of diversification and dispersion of rice yellow mottle virus RT inferred from large-scale and high-resolution phylogeographical studies"; RL Mol. Ecol. 14(7):2097-2110(2005). XX DR MD5; 7777e6188b853e84ca9927835ea8d75a. XX FH Key Location/Qualifiers FH FT source 1..720 FT /organism="Rice yellow mottle virus" FT /isolate="BF5" FT /mol_type="mRNA" FT /country="Burkina Faso" FT /db_xref="taxon:31744" FT CDS 1..720 FT /product="coat protein" FT /note="ORF4" FT /db_xref="GOA:Q9DH71" FT /db_xref="InterPro:IPR000937" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:Q9DH71" FT /experiment="experimental evidence, no additional details FT recorded" FT /protein_id="CAI59637.1" FT /translation="MARKGKKTNSNQGQQGKRKGRRPRGRSAEPQLQRAPVAQASRISG FT TVPGPLSSNTWPLHSVEFLADFKRSSTSADATTYDCVPFNLPRVWSLARCYSMWKPTRW FT DVVYLPEVSATVAGSIEMCFLYDYADTIPSDTGKMSRTAGFVTSSVWYGAEGCHLLSGG FT SARNAVVASMDCSRVGWKRVTSSIPSSVDPNVVNTILPARLAVRSSIKPTVSDTPGKLY FT VIASMVLRDPVDPTLNT" XX SQ Sequence 720 BP; 155 A; 194 C; 213 G; 158 T; 0 other; atggccagga agggcaagaa aaccaactcc aaccaggggc agcaaggaaa gaggaagggc 60 cgacgtccgc gtgggcggtc ggcggagccc cagcttcaac gggctccagt ggctcaggcc 120 tcccggatat ctgggacggt tcctggacca ctatcttcta acacctggcc gctccactcc 180 gttgagttcc tagcggactt taagcggagt tccacatcgg cggatgcgac gacatatgac 240 tgtgtgccgt tcaatctgcc tcgggtgtgg agtcttgcgc gttgttactc catgtggaag 300 ccaacacggt gggatgtcgt ttacctccct gaggtgagcg ccacggtagc tggaagtatc 360 gagatgtgtt ttctctacga ctatgctgac actatcccaa gtgacacggg caagatgagc 420 aggacggcgg gcttcgtcac ctctagcgtt tggtacggcg ctgagggctg ccacttacta 480 agtggtggct cagcacgaaa tgccgtggtc gcctcgatgg attgctcccg agtcggctgg 540 aaacgcgtta ctagttctat acctagtagc gtggatccca acgtcgtaaa caccatactg 600 ccagctaggc tagctgtgcg atcgtcgatc aaaccgacgg ttagtgatac accggggaaa 660 ctctatgtta tcgctagtat ggtcctgcgg gatccggttg atccaacact caatacgtga 720 //