ID AJ844586; SV 1; linear; genomic RNA; STD; VRL; 186 BP. XX AC AJ844586; XX DT 05-OCT-2004 (Rel. 81, Created) DT 05-OCT-2004 (Rel. 81, Last updated, Version 1) XX DE Carnation mottle virus p7 gene for Movement protein p7, genomic RNA, clone DE 395 XX KW Movement protein p7; p7 gene. XX OS Carnation mottle virus OC Viruses; Riboviria; Tombusviridae; Procedovirinae; Alphacarmovirus. XX RN [1] RP 1-186 RA Raikhy G.; RT ; RL Submitted (04-OCT-2004) to the INSDC. RL Raikhy G., Plant Virus Lab, Floriculture Division, Institute of Himalayan RL Bioresource Tech., P.O. Box 6, Palampur, Himachal Pradesh - 176061, INDIA. XX RN [2] RA Raikhy G., Hallan V., Kulshrestha S., Sandhu G., Verma R.R., Zaidi A.A.; RT "Variability studies of movement protein and coat protein genes of RT different Carnation mottle virus Indian strains"; RL Unpublished. XX DR MD5; 981b78bc98504e730ea49530f1fc5ec9. XX FH Key Location/Qualifiers FH FT source 1..186 FT /organism="Carnation mottle virus" FT /host="Dianthus caryophyllus" FT /lab_host="Dianthus barbatus" FT /isolate="Palampur" FT /mol_type="genomic RNA" FT /country="India:Northern Himalayan Region; Palampur" FT /clone="395" FT /db_xref="taxon:11986" FT CDS 1..186 FT /gene="p7" FT /product="Movement protein p7" FT /db_xref="GOA:Q5ZF36" FT /db_xref="InterPro:IPR007982" FT /db_xref="UniProtKB/TrEMBL:Q5ZF36" FT /protein_id="CAH59642.1" FT /translation="MDIESEVPVAGKQMLAGNRGKQKTRRSVAKDAIRKPASDSTNGGN FT WVNVADKIEVHIHFNF" XX SQ Sequence 186 BP; 61 A; 31 C; 49 G; 45 T; 0 other; atggatattg aatcggaagt accagtagct ggaaagcaaa tgctcgctgg gaatagagga 60 aaacaaaaga cacgtagatc ggtggccaag gatgccatcc gtaaacctgc atctgatagt 120 actaacgggg gtaattgggt taatgttgct gataagattg aagtgcacat tcacttcaac 180 ttttag 186 //