ID AJ844585; SV 1; linear; genomic RNA; STD; VRL; 255 BP. XX AC AJ844585; XX DT 05-OCT-2004 (Rel. 81, Created) DT 05-OCT-2004 (Rel. 81, Last updated, Version 1) XX DE Carnation mottle virus p9 gene for Movement protein p9, genomic RNA, clone DE 393 XX KW Movement protein p9; p9 gene. XX OS Carnation mottle virus OC Viruses; Riboviria; Tombusviridae; Procedovirinae; Alphacarmovirus. XX RN [1] RP 1-255 RA Raikhy G.; RT ; RL Submitted (04-OCT-2004) to the INSDC. RL Raikhy G., Plant Virus Lab, Floriculture Division, Institute of Himalayan RL Bioresource Tech., P.O. Box 6, Palampur, Himachal Pradesh - 176061, INDIA. XX RN [2] RA Raikhy G., Hallan V., Kulshrestha S., Sandhu G., Verma R.R., Zaidi A.A.; RT "Variability studies of movement protein and coat protein genes of RT different Carnation mottle virus Indian strains"; RL Unpublished. XX DR MD5; 91c2d2ec2cfd2257838715d9edf71ca3. XX FH Key Location/Qualifiers FH FT source 1..255 FT /organism="Carnation mottle virus" FT /host="Dianthus caryophyllus" FT /lab_host="Dianthus barbatus" FT /isolate="Palampur" FT /mol_type="genomic RNA" FT /country="India:Northern Himalayan Region, Palampur" FT /clone="393" FT /db_xref="taxon:11986" FT CDS 1..255 FT /gene="p9" FT /product="Movement protein p9" FT /db_xref="GOA:Q5ZF37" FT /db_xref="UniProtKB/TrEMBL:Q5ZF37" FT /protein_id="CAH59641.1" FT /translation="MPSVNLHLIVLTGVIGLMLLIRLKCTFTSTFSLPPLVTLNQIIAL FT SFCGLLLNSISRAERACYYNYSVDSSKQQHISISTPNGK" XX SQ Sequence 255 BP; 79 A; 51 C; 45 G; 80 T; 0 other; atgccatccg taaacctgca tctgatagta ctaacggggg taattgggtt aatgttgctg 60 ataagattga agtgcacatt cacttcaact tttagtttgc ccccactggt aactttaaat 120 cagattatag cgttgtcatt ttgtggtctt ctattaaaca gcatctctcg ggcagaaaga 180 gcttgctatt acaactactc tgttgatagt tccaaacaac aacacatttc tataagtaca 240 ccaaatggaa aataa 255 //