ID AJ844553; SV 1; linear; genomic RNA; STD; VRL; 255 BP. XX AC AJ844553; XX DT 05-OCT-2004 (Rel. 81, Created) DT 05-OCT-2004 (Rel. 81, Last updated, Version 1) XX DE Carnation mottle virus p9 gene for Movement protein p9, genomic RNA, DE isolate Solan XX KW Movement protein p9; p9 gene. XX OS Carnation mottle virus OC Viruses; Riboviria; Tombusviridae; Procedovirinae; Alphacarmovirus. XX RN [1] RP 1-255 RA Raikhy G.; RT ; RL Submitted (04-OCT-2004) to the INSDC. RL Raikhy G., Plant Virus Lab, Floriculture Division, Institute of Himalayan RL Bioresource Tech., PO Box # 6, Palampur, Distt. Kangra, Himachal Pradesh RL 176 061, INDIA. XX RN [2] RA Raikhy G., Hallan V., Kulshrestha S., Sandhu G., Verma R.R., Zaidi A.A.; RT "Variability studies of different Carnation mottle virus strains infecting RT carnations in India"; RL Unpublished. XX DR MD5; f5acd4b5e8a7fffd6135f1d3245a160f. XX FH Key Location/Qualifiers FH FT source 1..255 FT /organism="Carnation mottle virus" FT /host="Dianthus caryophyllus" FT /isolate="Solan" FT /mol_type="genomic RNA" FT /country="India:Northern Himalayan Region, Solan" FT /db_xref="taxon:11986" FT CDS 1..255 FT /gene="p9" FT /product="Movement protein p9" FT /db_xref="GOA:Q683S5" FT /db_xref="UniProtKB/TrEMBL:Q683S5" FT /protein_id="CAH59637.1" FT /translation="MPSVNLHLIVLTGVFGLMLLIRLRCTFTSTFSLPPLVTLNQIIAL FT SFCGLLLNSISRAERACYYNYSVDSSKQQHISISTPNGK" XX SQ Sequence 255 BP; 78 A; 52 C; 47 G; 78 T; 0 other; atgccatccg taaacctgca tctgatagta ctaacggggg tatttgggtt aatgttgctg 60 ataagattga ggtgcacatt cacttcaact tttagtttgc ccccactggt aactctaaat 120 cagataatag cgttgtcatt ttgtggtctt ctattaaaca gcatctctcg ggcagaaaga 180 gcttgctatt acaactactc tgttgatagt tccaaacaac aacacatttc gataagtaca 240 ccaaatggaa aataa 255 //