ID AJ831431; SV 1; linear; genomic RNA; STD; VRL; 195 BP. XX AC AJ831431; XX DT 15-SEP-2004 (Rel. 81, Created) DT 15-SEP-2004 (Rel. 81, Last updated, Version 1) XX DE Chrysanthemum virus B TGB3 gene for triple gene block 3, genomic RNA XX KW TGB3 gene; triple gene block 3. XX OS Chrysanthemum virus B OC Viruses; Riboviria; Tymovirales; Betaflexiviridae; Quinvirinae; Carlavirus. XX RN [1] RP 1-195 RA Singh L.; RT ; RL Submitted (11-SEP-2004) to the INSDC. RL Singh L., Floricultre Division, Institute of Himalayan Bioresource Tech., RL P.O.Box - 6, Palampur, Himachal Pradesh - 176061, INDIA. XX RN [2] RA Singh L., Singh A.K., Hallan V., Ram R., Zaidi A.A.; RT "Variability assessment of different ORFs in different Indian isolates of RT Chrysanthemum virus B"; RL Unpublished. XX DR MD5; e1bf3cea0aa44cf01e6e7903701447dd. XX FH Key Location/Qualifiers FH FT source 1..195 FT /organism="Chrysanthemum virus B" FT /isolate="Gwaliar" FT /mol_type="genomic RNA" FT /country="India:Gwaliar" FT /isolation_source="Chrysanthemum" FT /db_xref="taxon:12165" FT CDS 1..195 FT /gene="TGB3" FT /product="triple gene block 3" FT /db_xref="GOA:Q659T2" FT /db_xref="InterPro:IPR003411" FT /db_xref="UniProtKB/TrEMBL:Q659T2" FT /protein_id="CAH40793.1" FT /translation="MSLSYLDLFLIFGCALAVGVIVNCFLVSSNKCVIEITGEAVRISG FT CTFDSTFVELVKGLKPARH" XX SQ Sequence 195 BP; 44 A; 32 C; 52 G; 67 T; 0 other; atgtcattaa gttacttaga tctgttttta atcttcgggt gtgctctagc tgtaggagtt 60 atagtaaatt gctttctagt tagttccaat aagtgtgtga ttgaaataac cggtgaggcc 120 gtgaggattt ctggctgcac cttcgacagt actttcgttg agctggttaa ggggctcaag 180 ccggctaggc attag 195 //