ID AJ831428; SV 1; linear; genomic RNA; STD; VRL; 324 BP. XX AC AJ831428; XX DT 15-SEP-2004 (Rel. 81, Created) DT 15-SEP-2004 (Rel. 81, Last updated, Version 1) XX DE Chrysanthemum virus B ORF6 gene for 16 kDa protein, genomic RNA, isolate DE Rajsthan XX KW 16 kDa protein; ORF6. XX OS Chrysanthemum virus B OC Viruses; Riboviria; Tymovirales; Betaflexiviridae; Quinvirinae; Carlavirus. XX RN [1] RP 1-324 RA Singh L.; RT ; RL Submitted (06-SEP-2004) to the INSDC. RL Singh L., Floriculture Division, Institute of Himalayan Bioresource Tech., RL P.O. Box 6, Palampur, Himachal Pradesh - 176061, INDIA. XX RN [2] RA Singh L., Singh A.K., Hallan V., Ram R., Zaidi A.A.; RT "Variability assessment of different ORFs in different Indian isolates of RT Chrysanthemum virus B"; RL Unpublished. XX DR MD5; 9c3373923b46717e0e3c6f1dc4aff9d2. XX FH Key Location/Qualifiers FH FT source 1..324 FT /organism="Chrysanthemum virus B" FT /isolate="Rajsthan" FT /mol_type="genomic RNA" FT /country="India:Rajsthan" FT /isolation_source="Chrysanthemum" FT /db_xref="taxon:12165" FT CDS 1..324 FT /gene="ORF6" FT /product="16 kDa protein" FT /function="putative nucleic acid binding protein" FT /db_xref="GOA:Q709Q2" FT /db_xref="InterPro:IPR002568" FT /db_xref="UniProtKB/TrEMBL:Q709Q2" FT /protein_id="CAH40790.1" FT /translation="MDVIVKMLILRKFAEQGNVCPIHLCVDIYKRAFPRSVNKGRSSYA FT RRRRALELGRCHRCYRVYPPLFPEISRCDNRTCVPGISYNSKVRDYILWGVTEVIPHPG FT YNF" XX SQ Sequence 324 BP; 77 A; 62 C; 81 G; 104 T; 0 other; atggatgtga ttgtgaagat gttaatccta cgtaagtttg ctgaacaggg caatgtttgt 60 cctattcact tgtgtgttga tatttacaag cgtgctttcc ctaggagtgt gaataaaggt 120 agatcctcat acgctagacg tcgccgagct ctagagcttg gtaggtgcca taggtgttac 180 agggtctacc cccctttgtt tcccgagatt tctaggtgcg ataaccgcac ttgtgtgcct 240 ggtatttctt ataatagtaa agtgagagat tacatccttt ggggagtaac tgaggtgata 300 ccccaccctg ggtataattt ctaa 324 //