ID AJ830013; SV 1; linear; genomic RNA; STD; VRL; 324 BP. XX AC AJ830013; XX DT 09-SEP-2004 (Rel. 81, Created) DT 09-SEP-2004 (Rel. 81, Last updated, Version 1) XX DE Chrysanthemum virus B tgb2 gene for triple gene block 2 protein, genomic DE RNA, isolate Guwathi XX KW tgb2 gene; triple gene block 2 protein. XX OS Chrysanthemum virus B OC Viruses; Riboviria; Tymovirales; Betaflexiviridae; Quinvirinae; Carlavirus. XX RN [1] RP 1-324 RA Singh A.K.; RT ; RL Submitted (09-SEP-2004) to the INSDC. RL Singh A.K., Floriculture Division, Inst Himalayan Bioresource Technology, RL P.O.Box No. 6, Palampur, Himachal Pradesh - 176 061, INDIA. XX RN [2] RA Singh A.K., Singh L., Hallan V., Ram R., Zaidi A.A.; RT "Variability assessment of different ORFs among different isolates of RT Chrysanthemum virus B in India"; RL Unpublished. XX DR MD5; 15131f50a0d0de5c4eb3f55d225e7c7f. XX FH Key Location/Qualifiers FH FT source 1..324 FT /organism="Chrysanthemum virus B" FT /isolate="Guwahati" FT /mol_type="genomic RNA" FT /country="India:Guwahati" FT /db_xref="taxon:12165" FT CDS 1..324 FT /gene="tgb2" FT /product="triple gene block protein 2" FT /db_xref="GOA:Q683L2" FT /db_xref="InterPro:IPR001896" FT /db_xref="UniProtKB/TrEMBL:Q683L2" FT /protein_id="CAH25643.1" FT /translation="MPLTPPPDHTKALLIAAIGLSVVASILTYSRNTLPQVGDHSHLLP FT HGGVYKDGTKSIVYGGPRKLNSLEGGLNLPVQPWFLVILLSAVILLLSYRSGHRRCVCG FT QCH" XX SQ Sequence 324 BP; 76 A; 85 C; 74 G; 89 T; 0 other; atgcctctta cacctccacc tgatcacacg aaagctctcc ttattgcggc cattggcttg 60 agtgtcgtcg cttccatatt aacctacagc aggaacacac tccctcaggt gggcgatcat 120 tcacacctat taccgcacgg aggagtgtat aaagacggga ctaaatctat cgtctacggg 180 ggtcctagga aactgaactc gctcgaaggt ggactcaact taccagtaca accgtggttc 240 cttgtgatct tattgagtgc tgtcattctc ttacttagct atcgtagtgg gcatcgcagg 300 tgcgtctgtg gtcaatgtca ttaa 324 //