ID AJ810357; SV 1; linear; genomic DNA; STD; VRL; 771 BP. XX AC AJ810357; XX DT 20-APR-2005 (Rel. 83, Created) DT 22-APR-2005 (Rel. 83, Last updated, Version 2) XX DE Tomato leaf curl virus AV1 gene for coat protein, isolate 18 XX KW AV1 gene; coat protein. XX OS Tomato leaf curl virus OC Viruses; Geminiviridae; Begomovirus. XX RN [1] RP 1-771 RA Reddy C.R.V.; RT ; RL Submitted (02-AUG-2004) to the INSDC. RL Reddy C.R.V., Plant, Animal and Human Health Group,, University of RL Greenwich, Central Avenue, Chatham Maritime, Kent, ME4 4TB, UNITED KINGDOM. XX RN [2] RX DOI; 10.1007/s00705-004-0486-5. RX PUBMED; 15703846. RA Chowda Reddy R.V., Colvin J., Muniyappa V., Seal S.; RT "Diversity and distribution of begomoviruses infecting tomato in India"; RL Arch. Virol. 150(5):845-867(2005). XX DR MD5; 753e9bf7b2a386146bbe11408e211b13. XX FH Key Location/Qualifiers FH FT source 1..771 FT /organism="Tomato leaf curl virus" FT /host="malvastrum" FT /isolate="18" FT /mol_type="genomic DNA" FT /country="India:Panipat" FT /db_xref="taxon:28350" FT CDS 1..771 FT /gene="AV1" FT /product="coat protein" FT /db_xref="GOA:Q53II3" FT /db_xref="InterPro:IPR000263" FT /db_xref="InterPro:IPR000650" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:Q53II3" FT /protein_id="CAH17814.1" FT /translation="MAKRPADIVISTPASKVRRRLNFDSPYATRAVAPTVRVTKSRIWA FT NRPMYRKPRMYRMYRSPDVPKGCEGPCKVQSFDAKNDIGHMGKVICLSDVTRGIGLTHR FT VGKRFCVKSLYFVGKIWMDENIKIKNHTNTVLFWIVRDRRPSGTPNDFQQVFNVYDNEP FT STATVKNDQRDRFQVLRRFQATVTGGQYAAKEQAIIRRFYRVNNYVVYNHQEAGKYENH FT TENALLLYMACTHASNPVYATLKVRSYFYDSVTN" XX SQ Sequence 771 BP; 209 A; 165 C; 191 G; 206 T; 0 other; atggcgaagc gaccggcaga tatcgtcatt tctacccccg cgtcgaaggt gcgtcgtcga 60 ctgaacttcg acagcccata tgcaacccgt gcagttgccc ccactgtccg cgtcacaaag 120 tctcgcattt gggcgaacag gcccatgtac cggaagccca gaatgtacag gatgtacaga 180 agccctgatg ttcccaaagg atgtgaaggc ccatgtaagg tacagtcctt tgacgcgaag 240 aatgatattg ggcatatggg taaggttatc tgcctctctg atgttactag gggtattggg 300 ctgacccatc gagtagggaa acgtttttgt gtgaagtcat tgtattttgt tggcaaaata 360 tggatggacg agaacattaa gatcaagaac catacaaaca ccgttctgtt ctggatcgtg 420 agagacaggc gtccttcagg aactccaaac gatttccaac aagtgttcaa tgtttatgat 480 aatgagcctt ctacggctac tgtgaagaac gaccagcgtg atcggttcca ggtcttgagg 540 aggttccagg ccacagtcac aggtggtcaa tatgctgcta aggaacaggc tataattagg 600 agattttatc gtgttaacaa ttatgttgtt tataatcacc aggaagctgg gaagtatgag 660 aatcacaccg agaatgcttt attgttgtat atggcatgta cccatgcctc taaccccgtt 720 tatgctactt tgaaagttag aagctatttc tatgattctg taaccaattg a 771 //