ID AJ704763; SV 1; linear; genomic RNA; STD; VRL; 324 BP. XX AC AJ704763; XX DT 10-MAY-2004 (Rel. 79, Created) DT 10-MAY-2004 (Rel. 79, Last updated, Version 1) XX DE Chrysanthemum Virus B gene for 16 kDa protein, isolate Delhi XX KW . XX OS Chrysanthemum virus B OC Viruses; Riboviria; Tymovirales; Betaflexiviridae; Quinvirinae; Carlavirus. XX RN [1] RP 1-324 RA Singh A.K.; RT ; RL Submitted (07-MAY-2004) to the INSDC. RL Singh A.K., Floriculture Division, Inst Himalayan Bioresource Technology, RL P.O.Box No. 6, Palampur, Himachal Pradesh - 176 061, INDIA. XX RN [2] RA Singh A.K., Singh L., Hallan V., Ram R., Zaidi A.A.; RT "Variability assessment of different ORFs among different isolates of RT Chrysanthemum virus B in India"; RL Unpublished. XX DR MD5; f62fa94ffe847e8f6bb30b30a2fb3375. XX FH Key Location/Qualifiers FH FT source 1..324 FT /organism="Chrysanthemum virus B" FT /host="Chrysanthemum sp." FT /isolate="Delhi" FT /mol_type="genomic RNA" FT /country="India:Delhi" FT /db_xref="taxon:12165" FT CDS 1..324 FT /product="16 kDa protein" FT /db_xref="GOA:Q6ZX08" FT /db_xref="InterPro:IPR002568" FT /db_xref="UniProtKB/TrEMBL:Q6ZX08" FT /protein_id="CAG28923.1" FT /translation="MDAIVKMLILRKFVEQGNVCPIHLCVDIYKRAFPRSVNKGRSSYA FT RARRALELGRCHRCYRVYPPLFPEISRCDNRTCVPGISYNSKVRDYILWGVTEVIPHPG FT YNF" XX SQ Sequence 324 BP; 77 A; 59 C; 81 G; 107 T; 0 other; atggatgcga ttgtgaagat gcttatccta cgtaagtttg ttgaacaggg taatgtatgc 60 cctattcatt tgtgtgttga tatttacaag cgtgctttcc ctaggagtgt gaataaaggt 120 agatcctcat atgctagagc tcgccgagct ctagagcttg gtaggtgtca taggtgttac 180 agggtctacc cccctttgtt tcccgagatt tctaggtgcg ataatcgcac ttgtgtgcct 240 ggtatttctt ataatagtaa agtgagagat tacatccttt ggggagtaac tgaggtgata 300 ccccaccctg ggtataattt ctaa 324 //