ID AJ704627; SV 1; linear; genomic RNA; STD; VRL; 324 BP. XX AC AJ704627; XX DT 10-MAY-2004 (Rel. 79, Created) DT 10-MAY-2004 (Rel. 79, Last updated, Version 1) XX DE Chrysanthemum Virus B gene for 16kDa protein, genomic RNA, isolate Banglore XX KW 16kDa protein. XX OS Chrysanthemum virus B OC Viruses; Riboviria; Tymovirales; Betaflexiviridae; Quinvirinae; Carlavirus. XX RN [1] RP 1-324 RA Singh A.K.; RT ; RL Submitted (07-MAY-2004) to the INSDC. RL Singh A.K., Floriculture Division, Inst Himalayan Bioresource Technology, RL P.O.Box No. 6, Palampur, Himachal Pradesh - 176 061, INDIA. XX RN [2] RA Singh A.K., Singh L., Hallan V., Ram R., Zaidi A.A.; RT "Variability assessment of different ORFs among different isolates of RT Chrysanthemum virus B in India"; RL Unpublished. XX DR MD5; c3a9e033b2332ba1de2a3fe6a0b2f2b9. XX CC Chrysanthemum virus B complete 16kDa protien gene, isolate Banglore, India. CC start codon 1-324 XX FH Key Location/Qualifiers FH FT source 1..324 FT /organism="Chrysanthemum virus B" FT /host="Chrysanthemum" FT /isolate="Bangalore" FT /mol_type="genomic RNA" FT /db_xref="taxon:12165" FT CDS 1..324 FT /product="16kDa protein" FT /db_xref="GOA:Q6ZX09" FT /db_xref="InterPro:IPR002568" FT /db_xref="UniProtKB/TrEMBL:Q6ZX09" FT /protein_id="CAG28802.1" FT /translation="MDVIVKMIILRKFVEQGNVCPNHLCVDIYKRAFPRSVNKGRSSYA FT RRRRALELGRCHRCYRVYPPLFPEISRCDNRTCVPGISYNSKVRDYILWGVTEVIPHPG FT YNF" XX SQ Sequence 324 BP; 81 A; 57 C; 80 G; 106 T; 0 other; atggatgtga ttgtgaagat gataatccta cgtaagtttg ttgaacaggg taatgtatgc 60 cctaatcatt tgtgtgttga tatttacaag cgtgctttcc ctaggagtgt gaataaaggt 120 agatcttcat acgctagacg tcgccgagct ctagagcttg gtaggtgtca taggtgttac 180 agggtctacc ctcctttgtt tcccgagatt tctaggtgcg ataatcgcac ttgtgtgcct 240 ggtatttcct ataatagtaa agtaagagat tatatccttt ggggagtaac cgaggtgata 300 ccccaccctg ggtataattt ctaa 324 //