ID AJ617686; SV 2; linear; genomic RNA; STD; VRL; 324 BP. XX AC AJ617686; XX DT 16-DEC-2003 (Rel. 78, Created) DT 25-MAR-2004 (Rel. 79, Last updated, Version 2) XX DE Chrysanthemum virus B ORF1 DNA for hypothetical protein, genomic RNA XX KW ORF1. XX OS Chrysanthemum virus B OC Viruses; Riboviria; Tymovirales; Betaflexiviridae; Quinvirinae; Carlavirus. XX RN [1] RC revised by [3] RA Singh L.; RT ; RL Submitted (13-DEC-2003) to the INSDC. RL Singh L., Floriculture Division, Inst Himalayan Bioresource Technology, RL Post Box No.6, Palampur, Himachal Pradesh - 176 061, INDIA. XX RN [2] RA Singh L., Singh A.K., Hallan V., Ram R., Zaidi A.A.; RT "Variability assessment of different ORFs in different Indian isolates of RT Chrysanthemum virus B"; RL Unpublished. XX RN [3] RP 1-324 RA Singh L.; RT ; RL Submitted (19-MAR-2004) to the INSDC. RL Singh L., Floriculture Division, Inst Himalayan Bioresource Technology, RL Post Box No.6, Palampur, Himachal Pradesh - 176 061, INDIA. XX DR MD5; bd3005c5f6339cfb914d28cbb19b2e1d. XX FH Key Location/Qualifiers FH FT source 1..324 FT /organism="Chrysanthemum virus B" FT /isolate="Maharashtra" FT /mol_type="genomic RNA" FT /country="India:Maharashtra" FT /db_xref="taxon:12165" FT CDS 1..324 FT /product="hypothetical protein" FT /note="ORF1" FT /db_xref="GOA:Q707B3" FT /db_xref="InterPro:IPR002568" FT /db_xref="UniProtKB/TrEMBL:Q707B3" FT /protein_id="CAE85415.2" FT /translation="MDVIVKMLILRKFVEQGNVCPIHLCVDIYKRAFPRSVNKGRSSYA FT RHRRALELGRCHRCYRVYPPLFPEISRCDNRTCVPGISYNSKVRDYILWGVTEVIPHPG FT YNF" XX SQ Sequence 324 BP; 79 A; 60 C; 80 G; 105 T; 0 other; atggatgtga ttgtgaagat gctaatccta cgtaagtttg ttgaacaggg taatgtatgc 60 cctattcatt tgtgtgttga tatttacaag cgtgctttcc ctaggagtgt gaataaaggt 120 agatcttcgt acgccagaca ccgccgagct ctagagcttg gtagatgtca taggtgttac 180 agggtctacc cccctttgtt tcccgagatt tctaggtgcg ataatcgcac ttgtgtgcct 240 ggtatttctt ataatagtaa agtgagagat tacatccttt ggggagtaac tgaggtgata 300 ccccaccctg ggtataattt ctaa 324 //