ID AJ617529; SV 1; linear; genomic RNA; STD; VRL; 195 BP. XX AC AJ617529; XX DT 12-DEC-2003 (Rel. 78, Created) DT 12-DEC-2003 (Rel. 78, Last updated, Version 1) XX DE Chrysanthemum virus B TGB3 gene for triple gene block protein 3, genomic DE RNA, isolate Maharashtra XX KW TGB3 gene; triple gene block protein 3. XX OS Chrysanthemum virus B OC Viruses; Riboviria; Tymovirales; Betaflexiviridae; Quinvirinae; Carlavirus. XX RN [1] RP 1-195 RA Singh L.; RT ; RL Submitted (11-DEC-2003) to the INSDC. RL Singh L., Floriculture Division, Institute of Himalayan Bioresource Tech., RL P.O. Box - 6, Palampur, Himachal Pradesh - 176061, INDIA. XX RN [2] RA Singh L., Singh A.K., Hallan V., Ram R., Zaidi A.A.; RT "Variability assessment of different ORFs in different Indian isolates of RT Chrysanthemum virus B"; RL Unpublished. XX DR MD5; b989619d12a8ad396273d88402dde063. XX FH Key Location/Qualifiers FH FT source 1..195 FT /organism="Chrysanthemum virus B" FT /isolate="Maharashtra" FT /mol_type="genomic RNA" FT /country="India:Maharashtra" FT /db_xref="taxon:12165" FT CDS 1..195 FT /gene="TGB3" FT /product="triple gene block protein 3" FT /db_xref="InterPro:IPR003411" FT /db_xref="UniProtKB/TrEMBL:Q707S2" FT /protein_id="CAE84946.1" FT /translation="MSLSYLDLLLAFGCVLAVSVIINCFLVSPNNCVIEITGEAVRISG FT CTFDRTCVELVKGLKPARH" XX SQ Sequence 195 BP; 45 A; 31 C; 49 G; 70 T; 0 other; atgtcattaa gttacttaga cttactttta gcttttgggt gtgttttggc tgtgagtgtt 60 attattaatt gctttttagt tagccctaat aattgcgtga tagaaataac tggtgaagct 120 gtcaggattt ctggctgcac cttcgatagg acctgcgtcg aactggttaa agggctcaag 180 ccggctaggc attag 195 //