ID AJ617282; SV 1; linear; genomic RNA; STD; VRL; 324 BP. XX AC AJ617282; XX DT 10-DEC-2003 (Rel. 78, Created) DT 10-DEC-2003 (Rel. 78, Last updated, Version 1) XX DE Chrysanthemum virus B TGB2 gene for triple gene block protein 2, genomic DE RNA, isolate Bangalore XX KW TGB2 gene; triple gene block protein 2. XX OS Chrysanthemum virus B OC Viruses; Riboviria; Tymovirales; Betaflexiviridae; Quinvirinae; Carlavirus. XX RN [1] RP 1-324 RA Singh L.; RT ; RL Submitted (10-DEC-2003) to the INSDC. RL Singh L., Floriculture Division, Inst Himalayan Bioresource Technology, RL P.O.Box No. 6, Palampur, Himachal Pradesh - 176 061, INDIA. XX RN [2] RA Singh L., Singh A.K., Hallan V., Ram R., Zaidi A.A.; RT "Variability assessment of different ORFs among different isolates of RT Chrysanthemum virus B in India"; RL Unpublished. XX DR MD5; ab3e5cb999862fbff7ef5730d8dbd300. XX FH Key Location/Qualifiers FH FT source 1..324 FT /organism="Chrysanthemum virus B" FT /isolate="Bangalore" FT /mol_type="genomic RNA" FT /country="India:Bangalore" FT /db_xref="taxon:12165" FT CDS 1..324 FT /gene="TGB2" FT /product="triple gene block protein 2" FT /db_xref="GOA:Q708C2" FT /db_xref="InterPro:IPR001896" FT /db_xref="UniProtKB/TrEMBL:Q708C2" FT /protein_id="CAE84136.1" FT /translation="MPLTPPPDHTKVLLVAAIGLSIVASILTYSRNTLPLVGDHSHLLP FT HGGVYKDGTKTIIYGGPRKLNSLEGGFNLPVQPWFLVIPLSAAIFLLSCRSGHRRCVCG FT QCH" XX SQ Sequence 324 BP; 75 A; 78 C; 74 G; 97 T; 0 other; atgcctctta cacctccacc tgaccacacg aaagttctcc ttgttgcggc cattggcttg 60 agcattgtcg cgtctatatt gacttacagc aggaatacac ttcctctagt cggtgaccat 120 tcacatctgt tgccgcacgg tggtgtgtac aaagacggga caaagactat catttacgga 180 ggccctagga aactaaattc tctagagggt ggatttaact taccagtgca gccttggttc 240 cttgttatac cattaagtgc agccattttc ttacttagtt gtcgtagtgg gcaccgtagg 300 tgcgtctgtg gtcaatgtca ttaa 324 //