ID AJ584843; SV 1; linear; genomic RNA; STD; VRL; 186 BP. XX AC AJ584843; XX DT 10-OCT-2003 (Rel. 77, Created) DT 10-OCT-2003 (Rel. 77, Last updated, Version 1) XX DE Carnation mottle virus p7 gene for movement protein XX KW movement protein; p7 gene. XX OS Carnation mottle virus OC Viruses; Riboviria; Tombusviridae; Procedovirinae; Alphacarmovirus. XX RN [1] RP 1-186 RA Sherpa A.R.; RT ; RL Submitted (05-OCT-2003) to the INSDC. RL Sherpa A.R., Plant Virus Lab, Floriculture Division, Inst. of Himalayan RL Bioresource Technology, IHBT, P.B # 6, Palampur, Himachal Pradesh, 176061, RL INDIA. XX RN [2] RA Mishra M., Sherpa A.R., Hallan V.K., Zaidi A.A.; RT "Cloning and sequencing of movement protein genes (p7 & p9) of Indian RT Isolate of Carnation mottle virus"; RL Unpublished. XX DR MD5; a594f52a06435618b951851a0a7d2b44. XX FH Key Location/Qualifiers FH FT source 1..186 FT /organism="Carnation mottle virus" FT /host="Carnation" FT /lab_host="Saponaria" FT /mol_type="genomic RNA" FT /db_xref="taxon:11986" FT CDS 1..186 FT /gene="p7" FT /product="movement protein" FT /db_xref="GOA:Q70E27" FT /db_xref="InterPro:IPR007982" FT /db_xref="UniProtKB/TrEMBL:Q70E27" FT /protein_id="CAE51189.1" FT /translation="MDIESEVPVIEKQMLAGNRGKQKTRRSVAKDAIRKPASDSTNGGN FT WVNVADKIEVHIHFNF" XX SQ Sequence 186 BP; 63 A; 31 C; 47 G; 45 T; 0 other; atggatattg aatcggaagt accagtaatt gaaaagcaaa tgctcgctgg gaatagagga 60 aaacaaaaga cacgtagatc ggtggccaaa gatgccatcc gcaaacctgc atctgatagt 120 actaacgggg gtaattgggt taatgttgct gataagattg aggtgcacat tcacttcaac 180 ttttag 186 //