ID AJ584842; SV 1; linear; genomic RNA; STD; VRL; 255 BP. XX AC AJ584842; XX DT 10-OCT-2003 (Rel. 77, Created) DT 10-OCT-2003 (Rel. 77, Last updated, Version 1) XX DE Carnation mottle virus p9 gene for movement protein XX KW movement protein; p9 gene. XX OS Carnation mottle virus OC Viruses; Riboviria; Tombusviridae; Procedovirinae; Alphacarmovirus. XX RN [1] RP 1-255 RA Sherpa A.R.; RT ; RL Submitted (05-OCT-2003) to the INSDC. RL Sherpa A.R., Plant Virus Lab, Floriculture Division, Inst. of Himalayan RL Bioresource Technology, IHBT, P.B # 6, Palampur, Himachal Pradesh, 176061, RL INDIA. XX RN [2] RA Mishra M., Sherpa A.R., hallan V.K., Zaidi A.A.; RT "Cloning and sequencing of movement protein genes (p7 & p9) of Indian RT Isolate of Carnation mottle virus"; RL Unpublished. XX DR MD5; d879eb1f3a2fe5532d3935574be14fe9. XX FH Key Location/Qualifiers FH FT source 1..255 FT /organism="Carnation mottle virus" FT /host="Carnation" FT /lab_host="Saponaria" FT /mol_type="genomic RNA" FT /db_xref="taxon:11986" FT CDS 1..255 FT /gene="p9" FT /product="movement protein" FT /db_xref="GOA:Q70E28" FT /db_xref="UniProtKB/TrEMBL:Q70E28" FT /protein_id="CAE51188.1" FT /translation="MPSANLHLIVLTGEIGLMLLIRINCTFTSTFSLPPLVTLNQIIAL FT SFCGLLLNSISRAERACYYNYSVDSSKQQHISVSTPNGK" XX SQ Sequence 255 BP; 82 A; 51 C; 45 G; 77 T; 0 other; atgccatccg caaacctgca tctgatagta ctaacggggg aaattgggtt aatgttgctg 60 ataagaataa attgcacatt cacttcaact tttagtttgc ccccactggt aactctaaat 120 cagataatag cgttgtcatt ttgtggtctt ctattaaaca gcatctctcg ggcagaaaga 180 gcttgctatt acaattactc tgttgatagt tctaaacaac aacacatttc ggtaagtaca 240 ccaaatggaa aataa 255 //