ID AJ517473; SV 1; linear; mRNA; STD; VRL; 936 BP. XX AC AJ517473; XX DT 11-SEP-2003 (Rel. 77, Created) DT 19-SEP-2003 (Rel. 77, Last updated, Version 2) XX DE Barley yellow mosaic virus partial gene for polyprotein, genomic RNA1, DE isolate QLB, strain 1 XX KW 14 kDa protein; NIa protein; polyprotein; VPg protein. XX OS Barley yellow mosaic virus OC Viruses; Riboviria; Potyviridae; Bymovirus. XX RN [1] RP 1-936 RA Kanyuka K.; RT ; RL Submitted (19-NOV-2002) to the INSDC. RL Kanyuka K., Plant-Pathogen Interactions Division, Rothamsted Research, RL Harpenden, Hertfordshire, AL5 2JQ, UNITED KINGDOM. XX RN [2] RX DOI; 10.1099/vir.0.19347-0. RX PUBMED; 13679620. RA Kuehne T., Shi N., Proeseler G., Adams M., Kanyuka K.; RT "The ability of a bymovirus to overcome the rym4-mediated resistance in RT barley correlates with a codon change in the VPg coding region on RNA1."; RL J. Gen. Virol. 84(Pt 10):2853-2859(2003). XX DR MD5; 569f9335ab0fe13a6f9143732885f8ba. XX FH Key Location/Qualifiers FH FT source 1..936 FT /organism="Barley yellow mosaic virus" FT /host="Hordeum vulgare" FT /strain="1" FT /isolate="QLB" FT /mol_type="mRNA" FT /country="Germany" FT /db_xref="taxon:12465" FT CDS <1..>936 FT /codon_start=1 FT /product="polyprotein" FT /note="RNA1" FT /db_xref="GOA:Q70WG9" FT /db_xref="InterPro:IPR001730" FT /db_xref="UniProtKB/TrEMBL:Q70WG9" FT /protein_id="CAD57007.1" FT /translation="AVESKLCGFTFVFPDDDKIGLEGKGNKYRPREDARLMYSTREDAT FT FDAWNEKAKERRKKVTDKAEPELRRAYEKRPYFNFYDLQTDSNILEAIFYTTEGDEFFR FT TADPNRDMNLVADKLRSFLDTKLVVGHHQRKLLEETANVVIKDTKGTAHKMEISQHDPD FT FLKQNGSGKVGYPEHRGQFRQEGVAVTGDYDLEAEFGADADEITLEASTGILLSQVGVD FT VATRVGRICIGTFNMNCYFYSDWILVPGHLQDRSGNVTIQFPDQTVQTTTDALNANGVK FT RFYGLDVIAIRRPAILRPRTKLVKAFAIEEP" FT mat_peptide <1..66 FT /product="14 kDa protein" FT mat_peptide 67..627 FT /product="VPg protien" FT mat_peptide 628..>936 FT /product="NIa protein" XX SQ Sequence 936 BP; 283 A; 202 C; 223 G; 228 T; 0 other; gctgttgaga gcaaactatg tggcttcact tttgtttttc cagatgatga taaaattggt 60 cttgaaggca agggaaacaa ataccgccct cgcgaagacg ctcgcctgat gtactccact 120 agagaagacg ccacctttga cgcctggaat gagaaagcga aggaaagacg caagaaagta 180 accgacaaag ctgagccaga gcttcggaga gcctatgaaa agagaccata tttcaatttc 240 tacgaccttc aaacagatag caacattctg gaagctattt tctacaccac tgaaggtgat 300 gagtttttcc gaacagcaga ccctaacagg gacatgaact tggttgctga taaactgcgc 360 tcttttctcg atacaaagct tgttgttgga caccatcagc ggaagctact agaagaaaca 420 gctaatgttg ttatcaagga cacgaaggga actgcgcaca agatggaaat ttcacagcat 480 gatccagatt ttctgaagca gaatgggtcc ggcaaagttg ggtatccaga acaccgagga 540 cagtttaggc aggaaggagt tgccgtcaca ggggattacg atcttgaagc tgagtttggc 600 gccgatgctg atgaaataac gcttgaggcc tctactggaa ttttattgtc acaagttggg 660 gtcgatgttg caactcgagt tggaagaatt tgcattggca ctttcaatat gaactgttac 720 ttctatagcg actggattct agttccagga cacctgcaag atagatctgg caacgtaaca 780 attcaattcc ctgaccaaac agtgcaaacc acaaccgacg cactcaacgc aaatggtgtg 840 aaacgattct atggattaga tgtaatagca attcgtcgcc ctgctatctt acggcctcgc 900 accaagttgg tcaaagcttt tgctattgag gaacca 936 //