ID AJ512758; SV 1; linear; genomic DNA; STD; VRL; 524 BP. XX AC AJ512758; XX DT 25-OCT-2002 (Rel. 73, Created) DT 10-NOV-2003 (Rel. 77, Last updated, Version 4) XX DE Tobacco leaf curl Yunnan virus AV2 gene and partial AV1 gene for coat DE protein, isolate Y118 XX KW AV1 gene; AV2 gene; AV2 protein; coat protein. XX OS Tobacco leaf curl Yunnan virus OC Viruses; Geminiviridae; Begomovirus. XX RN [1] RP 1-524 RA Zhou X.; RT ; RL Submitted (21-OCT-2002) to the INSDC. RL Zhou X., Zhejiang University, Institute of Biotechnology, Kaixuan Road RL 268,HangZhou, Zhejiang,310029, CHINA. XX RN [2] RA Li G., Fan S., Li Z., Xie Y., Zhou X.; RT "Genomic characterization of DNA-A and associated satellite DNA mole cule RT of an isolate of Tomato Yellow leaf curl China virus infecting Nicotiana ta RT bacum White Burley in Yunnan"; RL Nong Ye Sheng Wu Ji Shu Xue Bao 11(5):525-530(2003). XX RN [3] RX DOI; 10.1007/s007050170081. RX PUBMED; 11676420. RA Zhou X.P., Xie Y., Zhang Z.K.; RT "Molecular characterization of a distinct begomovirus infecting tobacco in RT Yunnan, China"; RL Arch. Virol. 146(8):1599-1606(2001). XX DR MD5; 5d9fd46484023210bc7a9d517918d49c. XX FH Key Location/Qualifiers FH FT source 1..524 FT /organism="Tobacco leaf curl Yunnan virus" FT /isolate="Y118" FT /mol_type="genomic DNA" FT /country="China:Yunnan" FT /db_xref="taxon:211866" FT CDS 141..497 FT /transl_table=1 FT /gene="AV2" FT /product="AV2 protein" FT /db_xref="GOA:Q8AYU6" FT /db_xref="InterPro:IPR002511" FT /db_xref="InterPro:IPR005159" FT /db_xref="UniProtKB/TrEMBL:Q8AYU6" FT /protein_id="CAD54817.1" FT /translation="MWDPLLNEFPETVHGFRCMLAVKYLQLVEKTYSPDTLGHDLIRDL FT ISVIRARNYVEATSRYNHFHARFEGTPPSQLRQPICEPCCCPHCPRHQSKIMDEQAHEQ FT KAQDVQDVQKSRCP" FT CDS 301..>524 FT /transl_table=1 FT /gene="AV1" FT /product="coat protein" FT /db_xref="GOA:Q8B6W0" FT /db_xref="InterPro:IPR000263" FT /db_xref="UniProtKB/TrEMBL:Q8B6W0" FT /protein_id="CAD54818.1" FT /translation="MSKRPADIIISTPASKARRRLNFDSPYVSRAAAPIVRVTKARSWT FT NRPMNRKPKMYRMYRSPDVPRGCEGPCKV" XX SQ Sequence 524 BP; 143 A; 121 C; 117 G; 143 T; 0 other; taatattacc tgtgggccgc gatttttttt aaagtgggcc cgttgatgtg atatgtcatc 60 caatcagaat gctccttcaa agcttaattg ttttgtggtc ccttatttaa acttgctcac 120 caagtagtgc actccgcact atgtgggatc cattattaaa cgagtttccc gaaaccgttc 180 acggctttag gtgtatgtta gcagttaaat atctgcagtt agtagagaag acttattcgc 240 ctgatacatt agggcacgat ttaattaggg atttaatttc agttattagg gctagaaatt 300 atgtcgaagc gaccagcaga tataatcatt tccacgcccg cttcgaaggc acgccgccgt 360 ctcaacttcg acagcccata tgtgagccgt gctgctgccc ccattgtccg cgtcaccaaa 420 gcaagatcat ggacgaacag gcccatgaac agaaagccca agatgtacag gatgtacaga 480 agtccagatg tccctagagg atgtgaaggc ccatgcaaag tcca 524 //