ID AJ512755; SV 1; linear; genomic DNA; STD; VRL; 521 BP. XX AC AJ512755; XX DT 25-OCT-2002 (Rel. 73, Created) DT 10-NOV-2003 (Rel. 77, Last updated, Version 2) XX DE Tomato yellow leaf curl virus AV2 gene and partial AV1 gene for coat DE protein, isolate Y45 XX KW AV1 gene; AV2 gene; AV2 protein; coat protein. XX OS Tomato yellow leaf curl virus OC Viruses; Geminiviridae; Begomovirus. XX RN [1] RP 1-521 RA Zhou X.; RT ; RL Submitted (21-OCT-2002) to the INSDC. RL Zhou X., Zhejiang University, Institute of Biotechnology, Kaixuan Road RL 268,HangZhou, Zhejiang,310029, CHINA. XX RN [2] RA Li G., Fan S., Li Z., Xie Y., Zhou X.; RT "Genomic characterization of DNA-A and associated satellite DNA mole cule RT of an isolate of Tomato Yellow leaf curl China virus infecting Nicotiana ta RT bacum White Burley in Yunnan"; RL Nong Ye Sheng Wu Ji Shu Xue Bao 11(5):525-530(2003). XX DR MD5; d77166390bd62a021ba633c15ba89270. XX FH Key Location/Qualifiers FH FT source 1..521 FT /organism="Tomato yellow leaf curl virus" FT /isolate="Y45" FT /mol_type="genomic DNA" FT /country="China:Yunnan" FT /db_xref="taxon:10832" FT CDS 138..485 FT /gene="AV2" FT /product="AV2 protein" FT /db_xref="GOA:Q8B6T3" FT /db_xref="InterPro:IPR002511" FT /db_xref="InterPro:IPR005159" FT /db_xref="UniProtKB/TrEMBL:Q8B6T3" FT /protein_id="CAD54811.1" FT /translation="MWDPLLNEFPETVHGFRCMLAIKYLQLVENTYSPDTLGYDLIRDL FT ILVIRARDYVEASRRYSHFHSRLQGASPSELRQPLHTSCCCPHCPRHQKTNMDQQAHVS FT KAHDVPDVQKP" FT CDS 298..>521 FT /gene="AV1" FT /product="coat protein" FT /db_xref="GOA:Q8B6T2" FT /db_xref="UniProtKB/TrEMBL:Q8B6T2" FT /protein_id="CAD54812.1" FT /translation="MSKRPADIVISTPASKVRRRLNFDSPYTRRVAAPTVRVTRRQIWT FT NRPMYRKPMMYRMYRSPDVPKGCEGPCKV" XX SQ Sequence 521 BP; 129 A; 135 C; 116 G; 141 T; 0 other; taatattacc ggatggccgc gatttttttt aaagtggtcc cccccatgtg cgcgtttgtc 60 caatagaatg cgctcctcaa agcttattta ataaatggtc ccctataaaa cgtaggcccc 120 aagtttatac gttaaacatg tgggatccgt tgctcaatga gtttcccgaa accgtacacg 180 gttttaggtg tatgcttgca ataaaatact tgcagcttgt cgaaaatacg tattctccgg 240 atacgttggg ttacgatctt atacgggatc ttatcttggt tatacgtgcc agggattatg 300 tcgaagcgtc ccgccgatat agtcatttcc actcccgcct ccaaggtgcg tcgccgtctg 360 aacttcgaca gcccttacac acgtcgtgtt gctgccccca ctgtccgcgt caccagaaga 420 caaatatgga ccaacaggcc catgtatcga aagcccatga tgtaccggat gtacagaagc 480 cctgatgttc ccaagggttg tgaaggccca tgcaaagtcc a 521 //