ID AJ511805; SV 1; linear; mRNA; STD; VRL; 720 BP. XX AC AJ511805; XX DT 04-MAR-2003 (Rel. 75, Created) DT 26-APR-2018 (Rel. 136, Last updated, Version 2) XX DE Rice yellow mottle virus mRNA for coat protein (CP gene), isolate Ke1 XX KW coat protein; CP gene. XX OS Rice yellow mottle virus OC Viruses; Riboviria; Solemoviridae; Sobemovirus. XX RN [1] RP 1-720 RA Fargette D.; RT ; RL Submitted (14-OCT-2002) to the INSDC. RL Fargette D., DGPC, IRD, BP 64501, 34394 Montpellier cedex 5, FRANCE. XX RN [2] RX DOI; 10.1099/vir.0.18759-0. RX PUBMED; 12604826. RA Abubakar Z., Ali F., Pinel A., Traore O., Guessan P.N., Notteghem J.L., RA Kimmins F., Konate G., Fargette D.; RT "Phylogeography of Rice yellow mottle virus in Africa"; RL J. Gen. Virol. 84(Pt 3):733-743(2003). XX DR MD5; 74261b0989b92edcab7e877b8b6f790f. XX FH Key Location/Qualifiers FH FT source 1..720 FT /organism="Rice yellow mottle virus" FT /isolate="Ke1" FT /mol_type="mRNA" FT /country="Kenya" FT /db_xref="taxon:31744" FT CDS 1..720 FT /gene="CP" FT /product="coat protein" FT /db_xref="GOA:Q806X9" FT /db_xref="InterPro:IPR000937" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:Q806X9" FT /protein_id="CAD54295.1" FT /translation="MGRKGKKTNSNQGQQGKKKSRRPRGRSAEPQLQRAPVAQASRISG FT TVPGPLSSNSWPAHSVEFLMDFKRSATSAEATTFNCVPFNLPRVWSFGXCYSLWKPTRW FT DVIYLPEVSAATAGSIEMCYLYDYADAIPSDTGKMSRTAGFVTSSVWYGAEGCHLLSGG FT TARNAVVASMDCSRVGWRRVTGSIPSSVDPNVVNTILPARLAVRSSIKPTVDDVPGKLY FT AIVSMVLRDPVDPTLNT" XX SQ Sequence 720 BP; 156 A; 192 C; 216 G; 155 T; 1 other; atgggcagga agggcaagaa aaccaactcc aaccagggcc agcaaggaaa gaagaagagc 60 cgacgtcccc gtgggcgttc ggcggagccc cagcttcaac gggctccagt ggctcaggcc 120 tcccggatat ctgggacggt tcctggtcca ctatcttcta actcctggcc ggcccactcc 180 gtggaattcc taatggattt taagcggagt gccacatcgg cggaagcgac gacattcaac 240 tgtgtgccgt ttaatctgcc tcgggtgtgg agttttgggn gttgttactc actgtggaag 300 ccaacacggt gggacgtcat ctacctccct gaggttagtg cggcaacagc tggaagtatt 360 gagatgtgct atctctacga ctatgctgat gccatcccaa gtgacacggg caagatgagc 420 aggacggcgg gcttcgtcac ctctagcgtt tggtacggcg ctgagggctg ccacttgttg 480 agtggcggca cagcacgaaa tgccgtggtc gcctcgatgg attgctctcg agtcggctgg 540 agacgcgtta ctggttcaat acctagcagc gtggatccca acgtcgtaaa caccatactg 600 ccagcaaggc tagctgtgcg gtcgtcaatt aagccgacgg ttgatgatgt gccggggaaa 660 ctctacgcca tcgtcagtat ggtcctgcgg gatccggttg atccaacact caatacgtga 720 //