ID AJ252162; SV 2; linear; genomic RNA; STD; VRL; 510 BP. XX AC AJ252162; XX DT 07-JAN-2000 (Rel. 62, Created) DT 15-APR-2005 (Rel. 83, Last updated, Version 5) XX DE Kyuri green mottle mosaic virus cp gene for coat protein, genomic RNA XX KW coat protein; cp gene. XX OS Kyuri green mottle mosaic virus OC Viruses; Riboviria; Virgaviridae; Tobamovirus. XX RN [1] RC revised by [3] RA Ryu K.; RT ; RL Submitted (06-JAN-2000) to the INSDC. RL Ryu K., Horticultural Science, Seoul Women's University, Dept. RL Horticultural Science, Seoul Women's University, Seoul 139-774, SOUTH RL KOREA. XX RN [3] RP 1-510 RA Ryu K.; RT ; RL Submitted (11-FEB-2000) to the INSDC. RL Ryu K., Horticultural Science, Seoul Women's University, Dept. RL Horticultural Science, Seoul Women's University, Seoul 139-774, SOUTH RL KOREA. XX RN [4] RX DOI; 10.1007/s007050070023. RX PUBMED; 11205120. RA Ryu K.H., Min B.E., Choi G.S., Choi S.H., Kwon S.B., Noh G.M., Yoon J.Y., RA Choi Y.M., Jang S.H., Lee G.P., Cho K.H., Park W.M.; RT "Zucchini green mottle mosaic virus is a new tobamovirus; comparison of its RT coat protein gene with that of kyuri green mottle mosaic virus"; RL Arch. Virol. 145(11):2325-2333(2000). XX DR MD5; a81b26aab22445e9dad2f2f4cf7b4d04. XX FH Key Location/Qualifiers FH FT source 1..510 FT /organism="Kyuri green mottle mosaic virus" FT /sub_species="PVGB-PV-002" FT /strain="ATCC PV-392" FT /mol_type="genomic RNA" FT /country="Japan" FT /clone="pKGCPNCR" FT /db_xref="taxon:111970" FT CDS 1..510 FT /gene="cp" FT /product="coat protein" FT /function="viral encapsidation" FT /db_xref="GOA:Q9IW35" FT /db_xref="InterPro:IPR036417" FT /db_xref="UniProtKB/TrEMBL:Q9IW35" FT /experiment="experimental evidence, no additional details FT recorded" FT /protein_id="CAB65681.2" FT /translation="MNHLVYNKMSYSTSGIRSLPAFAKSFYPFYDVYNLLVSAQGGALQ FT TQNGKDILRESLTGLLTSVASLNSRFPANEFFVWSRESRIAAIIDSLLSALDSRNRAIE FT VENPSNPSTGEALNATKRNDDASTAAHNDIPLLLAALNDGVGVFDSASFESAFGLTWTA FT SATSSK" XX SQ Sequence 510 BP; 108 A; 121 C; 114 G; 167 T; 0 other; atgaaccacc tcgtttataa caagatgtct tactcaacca gtggtattcg ttcgcttcct 60 gctttcgcta agtcttttta tcctttttat gatgtgtata acctgttggt ttcggcccaa 120 ggaggtgctc tgcaaacgca aaatggtaaa gacattttgc gtgagtccct cactgggttg 180 ttaacttctg ttgcgtctct caattcacgt tttcctgcta atgagttttt cgtgtggtct 240 cgtgagtcgc gcattgctgc cataatcgat tcgttgttat ccgctttgga ttctagaaat 300 agggctatcg aagttgaaaa cccttctaat ccttctaccg gagaagctct gaatgcgacc 360 aagcgcaatg acgacgcgtc tacagccgcg cacaacgaca ttcctctgct tttagcagct 420 ctgaatgacg gtgtgggcgt ttttgatagt gcgtcttttg agtcagcttt cggtcttact 480 tggaccgcaa gcgctacttc ctcaaagtga 510 //