ID AJ010706; SV 1; linear; mRNA; STD; VRL; 945 BP. XX AC AJ010706; XX DT 27-AUG-1999 (Rel. 60, Created) DT 30-SEP-2000 (Rel. 65, Last updated, Version 2) XX DE Sweet potato feathery mottle virus mRNA for coat protein isolate RAK XX KW coat protein; cp gene. XX OS Sweet potato feathery mottle virus OC Viruses; Riboviria; Potyviridae; Potyvirus. XX RN [1] RP 1-945 RA Kreuze J.F.; RT ; RL Submitted (26-AUG-1998) to the INSDC. RL Kreuze J.F., Plant Biology, Swedish University of Agricultural sciences RL (SLU), BOX 7080, S-75007 Uppsala, SWEDEN. XX RN [2] RX DOI; 10.1007/s007050050047. RX PUBMED; 10795523. RA Kreuze J.F., Karyeija R.F., Gibson R.W., Valkonen J.J.P.T.; RT "Comparisons of coat protein gene sequences show that East African isolates RT of Sweet potato feathery mottle virus form a genetically distinct group"; RL Arch. Virol. 145(3):567-574(2000). XX DR MD5; 47e0c5b9362c6f1212f9e83016cb2df2. XX FH Key Location/Qualifiers FH FT source 1..945 FT /organism="Sweet potato feathery mottle virus" FT /isolate="RAK" FT /mol_type="mRNA" FT /db_xref="taxon:12844" FT CDS <1..>945 FT /gene="cp" FT /product="coat protein" FT /db_xref="GOA:Q9QNM0" FT /db_xref="InterPro:IPR001592" FT /db_xref="UniProtKB/TrEMBL:Q9QNM0" FT /protein_id="CAB53557.1" FT /translation="SNERTEFKDAGADPPAPKPKNVPPPPTITEITDPEDPKQAALKAA FT RAKQPAVIPESYGRDTSKEKESIVGTSSKGVRDKDVNVGTVGTFVVPRVKMNANKKRQP FT MVNGRAIINFQHLSTYEPEQFEVANTRSTQEQFQAWYEGVKGDYGVDDTGMGILLNGLM FT VWCIENGTSPNINGVWTMMDGDEQVTYPIKPLLDHAVPTFRQIMTHFSDVAEAYIEMXN FT RTKAYMPRYGLQRNLTDMSLARYAFDFYELHSTTPARAKEAHLQMKAAALKNARNRLFG FT LDGDVSTQEEDTERHTTTDVTRNIHNLLGMRGVQ" XX SQ Sequence 945 BP; 306 A; 183 C; 238 G; 213 T; 5 other; tctaatgaga gaactgaatt taaagatgca ggagcggacc ctccagcccc taagcctaag 60 aacgttcctc caccacccac aataactgar atcactgatc cagaggaccc gaagcaggca 120 gctttgaaag ctgcacgagc aaagcaaccc gcagtcattc cggagtcata tggacgagac 180 acgagcaaag aaaaggagtc aatagtgggg acatcatcaa agggtgtgag ggataaagat 240 gtgaatgttg gcactgttgg tacatttgtt gtgccacgtg tcaagatgaa tgcaaayaag 300 aaaaggcaac caatggtcaa tggaagggcy attataaatt tccagcactt gtcaacatat 360 gaaccagagc agtttgaggt tgcaaacacc cggtcaactc aagaacagtt tcaagcatgg 420 tatgaaggag ttaaagggga ttatggtgtt gacgacacag ggatggggat yttattgaat 480 ggactaatgg tttggtgcat tgaaaatggc acatccccaa acataaatgg tgtgtggaca 540 atgatggatg gtgatgagca agtgacatat ccaattaaac cattactgga ccatgcagtg 600 cctactttta ggcagattat gacgcacttc agtgacgttg ctgaagctta catagagatg 660 csaaaccgta caaaggcata catgccaagg tatggtctac aacgtaattt gactgatatg 720 agtcttgcgc gatatgcatt tgatttttac gagctgcatt caactacacc tgcacgtgct 780 aaagaagcac atttacagat gaaggcagcc gcacttaaga atgcgcgaaa tcggttgttt 840 ggtttggacg gagacgtctc cacgcaagaa gaagatacgg agaggcacac gacaactgat 900 gttactagaa atatacataa cctcttagga atgaggggtg tgcaa 945 //