ID AF515817; SV 1; linear; mRNA; STD; VRL; 831 BP. XX AC AF515817; XX DT 08-JUL-2002 (Rel. 72, Created) DT 08-JUL-2002 (Rel. 72, Last updated, Version 1) XX DE Peanut bud necrosis virus isolate Tomato nucleocapsid protein (N) mRNA, DE complete cds. XX KW . XX OS Peanut bud necrosis virus OC Viruses; Riboviria; Negarnaviricota; Polyploviricotina; Ellioviricetes; OC Bunyavirales; Tospoviridae; Orthotospovirus. XX RN [1] RP 1-831 RA Jain R.K., Maheswaran U., Bhat I.A.; RT "Nucleocapsid protein properties suggest that tomato Tospovirus is a strain RT of Peanut bud necrosis virus"; RL Unpublished. XX RN [2] RP 1-831 RA Jain R.K., Maheswaran U., Bhat I.A.; RT ; RL Submitted (29-MAY-2002) to the INSDC. RL Division of Plant Pathology, Indian Agricultural Research Institute, Pusa, RL New Delhi, Delhi 110 012, India XX DR MD5; b8ac016b4ff11661000594ce1c9b1972. XX FH Key Location/Qualifiers FH FT source 1..831 FT /organism="Peanut bud necrosis virus" FT /isolate="Tomato" FT /mol_type="mRNA" FT /db_xref="taxon:40687" FT CDS 1..831 FT /codon_start=1 FT /gene="N" FT /product="nucleocapsid protein" FT /db_xref="GOA:Q8JQA3" FT /db_xref="InterPro:IPR002517" FT /db_xref="UniProtKB/TrEMBL:Q8JQA3" FT /protein_id="AAM76043.1" FT /translation="MSNVKQLTEKKIKELLAGGSADVEIETEDSTPGFSFKAFYDSNKN FT IEITFTNCLNILKCRKQIFAACKSGKYVFCGKTIVATNTDVGPDDWTFKRTEAFIRTKM FT ASMVEKSKNDAAKQEMYTKIMELPLVAAYGLNVPAAFDACALRMMLCIGGPLPLLSSIT FT GLAPIIFPLAYYQNVKKEKLGIKNFSTYEQVCKVAKVLSASQIEFKAELDEMFKSAVKL FT LSESNPGTASSISLKKYDEQVKYMDKAFSASLSMDDYGEHSKKKSSKPGPSLEL" XX SQ Sequence 831 BP; 268 A; 143 C; 182 G; 238 T; 0 other; atgtctaacg ttaagcagct caccgagaag aaaatcaaag aacttttggc tggtggctct 60 gcagatgttg aaatcgaaac agaagattcc actcctgggt ttagctttaa agctttctat 120 gacagtaaca aaaatattga gataactttc acaaactgtt taaatattct gaagtgcaga 180 aagcagatct ttgctgcttg taaaagtggt aagtatgtct tttgtggtaa aactattgtt 240 gctacaaaca ctgatgtagg accagacgac tggaccttca aaagaacgga agctttcatc 300 aggaccaaaa tggctagtat ggttgaaaag agcaaaaatg atgctgctaa gcaggagatg 360 tacactaaaa taatggagtt gccattagtg gcagcttatg gattgaatgt ccctgcagct 420 ttcgatgcat gtgctttgag gatgatgctc tgcattggag gtcctctgcc tctcttgtct 480 agcataacag gtctggcacc aattatattc cctctggctt attatcaaaa tgtgaagaaa 540 gagaagttgg gtattaagaa cttctccact tatgaacagg tttgcaaggt agccaaagta 600 ctttctgctt cacagattga atttaaagct gaactagatg aaatgtttaa atcagctgta 660 aagctattga gtgaaagcaa ccctggaaca gccagctcta tttcactcaa gaaatatgat 720 gaacaggtta aatatatgga taaagctttc agtgcaagtc tctcaatgga tgattatggt 780 gaacattcta agaagaagag ttcaaagcct ggtccttcgc tggaattgta a 831 //