ID AF455274; SV 1; linear; mRNA; STD; VRL; 477 BP. XX AC AF455274; XX DT 31-DEC-2004 (Rel. 82, Created) DT 15-APR-2005 (Rel. 83, Last updated, Version 2) XX DE Odontoglossum ringspot virus from Phalaenopsis coat protein mRNA, complete DE cds. XX KW . XX OS Odontoglossum ringspot virus OC Viruses; Riboviria; Virgaviridae; Tobamovirus. XX RN [1] RP 1-477 RA Ajjikuttira P.A., Loh C.S., Ong C.A., Wong S.M.; RT "Variability of the coat protein gene of Odontoglossum ringspot RT tobamovirus"; RL Unpublished. XX RN [2] RP 1-477 RA Ajjikuttira P.A., Loh C.S., Ong C.A., Wong S.M.; RT ; RL Submitted (05-DEC-2001) to the INSDC. RL Biological Sciences, National University of Singapore, Block S2, 14 Science RL Drive 4, Singapore 117543, Singapore XX DR MD5; 712e062a617f4baf3a9db42dfe2bd364. XX FH Key Location/Qualifiers FH FT source 1..477 FT /organism="Odontoglossum ringspot virus" FT /host="Phalaenopsis" FT /mol_type="mRNA" FT /country="Taiwan" FT /db_xref="taxon:12238" FT CDS 1..477 FT /codon_start=1 FT /product="coat protein" FT /note="viral encapsulation and long distance movement" FT /db_xref="GOA:Q5K647" FT /db_xref="InterPro:IPR001337" FT /db_xref="InterPro:IPR036417" FT /db_xref="UniProtKB/TrEMBL:Q5K647" FT /protein_id="AAQ04717.1" FT /translation="MSYTITDPSKLAYLSSTWADPNSLINLCTNSLGNQFQTQQARTTV FT QQQFADVWQPVPTLTSRFPAGAGYFRVYRYDPILDPLITFLMGTFDTRNRIIEVENPQN FT PTTTETLDATRRVDDATVAIRSAINNLLNELVRGTGMYNQVSFETMSGLTWTSS" XX SQ Sequence 477 BP; 140 A; 101 C; 91 G; 145 T; 0 other; atgtcttaca ctattacaga cccgtctaag ctggcttatt taagctcgac ttgggctgac 60 cccaattcac taatcaacct ttgtaccaat tctctgggta atcagttcca aacacaacaa 120 gctcgaacaa ctgttcaaca gcagtttgct gatgtttggc agccggttcc tactttgacc 180 agtaggttcc ctgcaggcgc tggttacttc agagtttatc gctatgatcc tatattagat 240 cctttaataa ctttcttaat gggtactttt gatactcgta atagaataat cgaggtagaa 300 aatccgcaga atccgacaac tacggaaaca ttagatgcaa ctcgtagagt tgatgatgca 360 actgtagcaa taagatctgc aataaataat ctattaaatg agttagttag gggaactggt 420 atgtacaatc aagtctcatt tgagacgatg tctggactta cttggacctc ttcctaa 477 //