ID AF438410; SV 1; linear; genomic RNA; STD; VRL; 594 BP. XX AC AF438410; XX DT 13-DEC-2001 (Rel. 70, Created) DT 10-MAY-2004 (Rel. 79, Last updated, Version 2) XX DE Grapevine virus B coat protein gene, complete cds. XX KW . XX OS Grapevine virus B OC Viruses; Riboviria; Tymovirales; Betaflexiviridae; Trivirinae; Vitivirus. XX RN [1] RP 1-594 RA Nickel O., Fajardo T.V.M., Aragio F.J.L., Kuhn G.B.; RT "Coat protein gene characterization of Grapevine virus B from corky RT bark-affected grapevines"; RL Fitopatol. Bras. 26:534-535(2001). XX RN [2] RP 1-594 RA Nickel O., Fajardo T.V.M., Aragio F.H.L., Chagas C.M., Kuhn G.B.; RT "Detection and coat protein gene characterization of an isolate of RT Grapevine virus B from corky bark-affected grapevines in Southern Brazil"; RL Fitopatol. Bras. 27(3):279-284(2002). XX RN [3] RP 1-594 RA Nickel O., Fajardo T.V.M., Aragio F.J.L., Chagas C.M., Kuhn G.B.; RT "Detection and coat protein gene characterization of an isolate of RT Grapevine virus B from corky bark-affected grapevines in Southern Brazil"; RL Unpublished. XX RN [4] RP 1-594 RA Nickel O., Fajardo T.V.M., Aragio F.J.L., Chagas C.M., Kuhn G.B.; RT ; RL Submitted (22-OCT-2001) to the INSDC. RL Embrapa Uva e Vinho, Embrapa, Rua Livramento, 515, Bento Goncalves, RS RL 95700-000, Brasil XX DR MD5; aa344c4b8dbeac706316b0a9e4cbdda8. XX FH Key Location/Qualifiers FH FT source 1..594 FT /organism="Grapevine virus B" FT /isolate="BR1" FT /mol_type="genomic RNA" FT /db_xref="taxon:35289" FT CDS 1..594 FT /codon_start=1 FT /product="coat protein" FT /note="capsid protein" FT /db_xref="GOA:Q8V2G9" FT /db_xref="InterPro:IPR008879" FT /db_xref="UniProtKB/TrEMBL:Q8V2G9" FT /protein_id="AAL40797.1" FT /translation="MENISRMAKIRANISELLCAGVTFVTDARETGFDRPMYFRTLFGY FT IALTGTSAKAQHYENVDIIGDKVGAEGLDSRGTVNISEQVKKMMGYSRAVPSGVCKGLT FT LRQMCEPFAEEARDCLTILATLRVYSRLALKMAKLGQKEPQVMFDFNSGLNLLALSATE FT ASAIQSLNSRLFRTEGAKNVFTAQASVGEQSVEI" XX SQ Sequence 594 BP; 169 A; 130 C; 157 G; 138 T; 0 other; atggaaaata tatcccggat ggcaaaaata agggcgaata tctccgagct cctgtgcgcg 60 ggagtcacat ttgtaactga cgcccgtgaa actgggtttg atcgtcccat gtacttcagg 120 accctattcg ggtacattgc attaactggg acatcagcaa aagcacagca ctacgagaat 180 gtagatatta taggtgataa agtaggagca gagggtctag atagtagggg aactgtcaat 240 atctcggaac aggtgaagaa gatgatgggt tactctcgag cagtaccatc tggggtgtgt 300 aagggcctta ctctgaggca aatgtgtgaa cctttcgcag aggaagctag ggactgcttg 360 actatcctgg caaccctgag ggtatacagc aggctcgcac tcaagatggc caaactgggc 420 caaaaagaac cccaagttat gttcgatttt aactctggtc ttaacctgct cgctctatcc 480 gctaccgagg catctgcaat acaatctctg aactcaaggc tctttcgaac tgagggtgca 540 aagaacgtat tcacagcaca agccagcgtg ggtgagcagt ctgtcgagat atag 594 //