ID AF406778; SV 1; linear; mRNA; STD; VRL; 477 BP. XX AC AF406778; XX DT 31-DEC-2004 (Rel. 82, Created) DT 15-APR-2005 (Rel. 83, Last updated, Version 2) XX DE Odontoglossum ringspot virus isolate 2 from Singapore coat protein mRNA, DE complete cds. XX KW . XX OS Odontoglossum ringspot virus OC Viruses; Riboviria; Virgaviridae; Tobamovirus. XX RN [1] RP 1-477 RA Ajjikuttira P., Ryu K.H., Ong C.A., Loh C.S., Wong S.M.; RT "Variability in the coat protein gene of Odontoglossum ringspot virus"; RL Unpublished. XX RN [2] RP 1-477 RA Ajjikuttira P., Loh C.S., Wong S.M.; RT ; RL Submitted (03-AUG-2001) to the INSDC. RL Biological Sciences, National University of Singapore, Block S2, 14 Science RL Drive 4 117543, Singapore XX DR MD5; 87c69c7768bfef9e949a1acefcb5d02b. XX FH Key Location/Qualifiers FH FT source 1..477 FT /organism="Odontoglossum ringspot virus" FT /host="Aranda Nasreen Gayoon" FT /isolate="2" FT /mol_type="mRNA" FT /country="Singapore" FT /db_xref="taxon:12238" FT CDS 1..477 FT /codon_start=1 FT /product="coat protein" FT /note="viral encapsulation and long distance movement" FT /db_xref="GOA:Q5K6A9" FT /db_xref="InterPro:IPR001337" FT /db_xref="InterPro:IPR036417" FT /db_xref="UniProtKB/TrEMBL:Q5K6A9" FT /protein_id="AAQ03167.1" FT /translation="MSYTITDPSKLAYLSSAWADPNSLINLCTNSLGNQFQTQQARTTV FT QQQFADVWQPVPTLTSRFPAGAGYFRVYRYDPKLDPLITFLMGTFDTRNRIIEVENPQN FT PTTTETLDATRRVDDATVAIRSAINNLLNELVRGTGMYNQVSFETMSGLTWTSS" XX SQ Sequence 477 BP; 140 A; 106 C; 92 G; 139 T; 0 other; atgtcttaca ctattacaga cccgtctaag ctggcttatt taagctcggc ttgggctgac 60 cccaattcac taatcaacct ttgtaccaat tctctgggta atcagttcca aacacaacaa 120 gctcgaacaa ctgttcaaca gcagtttgct gatgtttggc agccggtccc tactttgacc 180 agtaggttcc ctgcaggcgc tggttacttc agagtttatc gctatgatcc taaattagat 240 cctttaataa ctttcttaat gggtaccttt gatactcgta atagaataat cgaggtagaa 300 aatccgcaga atccgacaac tacggaaaca ttagacgcaa ctcgtagagt tgatgatgca 360 actgtagcaa taagatctgc aataaataat ctattaaacg agttagttag gggaactggc 420 atgtacaatc aagtctcatt tgagacgatg tctggactta cttggacctc ttcctaa 477 //