ID AF208740; SV 1; linear; genomic RNA; STD; VRL; 769 BP. XX AC AF208740; XX DT 03-DEC-2000 (Rel. 66, Created) DT 29-MAY-2003 (Rel. 75, Last updated, Version 2) XX DE Prune dwarf virus isolate 21/1 movement protein (mp) gene, partial cds; and DE capsid protein (cp) gene, complete cds. XX KW . XX OS Prune dwarf virus OC Viruses; Riboviria; Bromoviridae; Ilarvirus. XX RN [1] RP 1-769 RA Vaskova D., Petrzik K., Spak J.; RT "Variability of the Capsid Protein of the Prune Dwarf Virus"; RL Unpublished. XX RN [2] RP 1-769 RA Vaskova D.; RT ; RL Submitted (29-NOV-1999) to the INSDC. RL Institute of Plant Molecular Biology, Academy of Sciences of the Czech RL Republic, Branisovska 31, Ceske Budejovice 370 05, Czech Republic XX DR MD5; e28bd82ccb2a77a49c937493bd3bf333. XX FH Key Location/Qualifiers FH FT source 1..769 FT /organism="Prune dwarf virus" FT /segment="RNA3" FT /host="cherry" FT /variety="Hudson" FT /isolate="21/1" FT /mol_type="genomic RNA" FT /country="Czech Republic:Research and Breeding Institute of FT Pomology, 50801 Holovousy" FT /db_xref="taxon:33760" FT CDS <1..26 FT /codon_start=3 FT /gene="mp" FT /product="movement protein" FT /protein_id="AAG35750.1" FT /translation="AFGVTIG" FT CDS 99..755 FT /codon_start=1 FT /gene="cp" FT /product="capsid protein" FT /note="structural" FT /db_xref="GOA:Q9DRZ9" FT /db_xref="InterPro:IPR002681" FT /db_xref="UniProtKB/TrEMBL:Q9DRZ9" FT /protein_id="AAG35749.1" FT /translation="MSGKATKSGKPTTRSQSFALARKNNNTTPPAGFVKKQFPGGSSKS FT ISEWMLHGPNVSVKSFSGMISRTENLTVNSTASGVYYTMKVRELFKDFTADTKVYGIVF FT RYCLDVSNGVYGLIKGFDVNAPVAPNPLQRRKFTAKQASGVQILAPTGMTVGDIPDDLW FT FVIKYDNAFQPNVPVWFCTQYLQHSMPKRVEIPDSVLYAERDTALMDAMDKIVSG" XX SQ Sequence 769 BP; 197 A; 170 C; 169 G; 233 T; 0 other; aagcttttgg tgtgacgatt ggttaactca ctttgtgagt taatagctcg ttttgtttac 60 caatttactt ccaactttcg actgtttatt ctctcaaaat gtctgggaaa gccactaaat 120 ctggaaagcc tactacccga tcacaaagct ttgctttagc tcggaagaat aataatacta 180 cccctcctgc tggttttgtt aagaaacaat tcccaggcgg aagctcgaag tctatttccg 240 agtggatgct tcacggaccg aatgtgtccg tgaaaagttt ttccggtatg atatctcgta 300 ccgagaatct gacagtcaat tcgactgctt ccggtgtgta ttacaccatg aaagtccgtg 360 aacttttcaa ggactttacc gctgatacca aggtgtacgg aattgtcttc cgttactgcc 420 ttgacgtttc taatggtgtc tacggactca ttaaaggttt cgatgtgaat gcgcctgtgg 480 cgcctaatcc cctacaacgt aggaagttca cagcgaaaca agccagtggg gtgcaaattc 540 ttgctcctac tggtatgacc gttggagata taccagatga tctctggttt gtcataaaat 600 atgacaatgc ttttcagccc aacgttccgg tgtggttttg tactcagtac ctccaacact 660 cgatgcccaa gagagttgag atccctgatt cagtgttata cgctgaacgg gatactgccc 720 ttatggatgc gatggataaa atagtcagtg gatgactata tgatccatc 769 //