ID AF208737; SV 1; linear; genomic RNA; STD; VRL; 769 BP. XX AC AF208737; XX DT 03-DEC-2000 (Rel. 66, Created) DT 29-MAY-2003 (Rel. 75, Last updated, Version 2) XX DE Prune dwarf virus isolate 2/16 movement protein (mp) gene, partial cds; and DE capsid protein (cp) gene, complete cds. XX KW . XX OS Prune dwarf virus OC Viruses; Riboviria; Bromoviridae; Ilarvirus. XX RN [1] RP 1-769 RA Vaskova D., Petrzik K., Spak J.; RT "Variability of the Capsid Protein of the Prune Dwarf Virus"; RL Unpublished. XX RN [2] RP 1-769 RA Vaskova D.; RT ; RL Submitted (29-NOV-1999) to the INSDC. RL Institute of Plant Molecular Biology, Academy of Sciences of the Czech RL Republic, Branisovska 31, Ceske Budejovice 370 05, Czech Republic XX DR MD5; 8e3cfbaae9008d2fba104f7941bf82cf. XX FH Key Location/Qualifiers FH FT source 1..769 FT /organism="Prune dwarf virus" FT /segment="RNA3" FT /host="cherry" FT /variety="Kasinova" FT /isolate="2/16" FT /mol_type="genomic RNA" FT /country="Czech Republic:Research and Breeding Institute of FT Pomology, 50801 Holovousy" FT /db_xref="taxon:33760" FT CDS <1..26 FT /codon_start=3 FT /gene="mp" FT /product="movement protein" FT /protein_id="AAG35744.1" FT /translation="AFGVTIG" FT CDS 99..755 FT /codon_start=1 FT /gene="cp" FT /product="capsid protein" FT /note="structural" FT /db_xref="GOA:Q9DS02" FT /db_xref="InterPro:IPR002681" FT /db_xref="UniProtKB/TrEMBL:Q9DS02" FT /protein_id="AAG35743.1" FT /translation="MSGKAIKSGKPTTRSQSFALARKNNNTTPPAGFVKKQFPGGSSKS FT ISEWMLHGPNVSVKSFSGMISRTENLTVNSTASGVYYTMKVRELFKDFAVDTKVYGIVF FT RYCLDVSNGVYGLIKGFDVNAPVAPNPLQRRKFTAKQASGVQILAPTGMTVGDIPDDLW FT FVIKYDNAFQPDVPVWFCTQYLQHSMPKRVEVPDSVLYAERDTALMDAMDKIVSG" XX SQ Sequence 769 BP; 193 A; 169 C; 173 G; 234 T; 0 other; aagcttttgg tgtgacgatt ggttaactca ctttgtgagt taatagctcg ttttgttcac 60 caatttactt ccaactttcg actgtttgtt ctctcaaaat gtctgggaaa gccattaaat 120 ctggaaagcc tactacccga tcacaaagct tcgctttagc tcggaagaat aataatacta 180 cccctcctgc tggttttgtt aagaaacaat tcccaggcgg aagctcgaag tctatttccg 240 agtggatgct tcacggacca aatgtgtccg tgaaaagttt ttccggtatg atatctcgta 300 ccgagaactt gacagtcaat tcgactgctt ccggtgtata ttacaccatg aaagtccgcg 360 aacttttcaa ggactttgct gttgatacca aggtgtacgg aattgttttc cgttactgcc 420 ttgatgtttc taatggtgtc tacggactca ttaaaggttt cgatgtgaat gcgcctgtgg 480 cgcctaatcc cctacaacgt aggaagttca cagcgaaaca ggccagtggg gtgcaaattc 540 ttgctcctac tggtatgacc gtcggagata taccagatga tctctggttt gtcataaaat 600 atgacaatgc ttttcagccc gacgttccgg tgtggttttg tactcagtac ctccaacact 660 cgatgcctaa gagagttgag gtccctgatt cagtgttata cgctgagcgg gacactgccc 720 ttatggatgc gatggataaa atagtcagtg gatgactata tgatccatc 769 //