ID AF144307; SV 1; linear; genomic RNA; STD; VRL; 865 BP. XX AC AF144307; XX DT 01-SEP-1999 (Rel. 60, Created) DT 15-APR-2005 (Rel. 83, Last updated, Version 4) XX DE Influenza A virus (A/Goose/Guangdong/1/96(H5N1)) nonstructural proteins NS1 DE and NS2 (NS) gene, alternatively spliced products, complete cds. XX KW . XX OS Influenza A virus (A/goose/Guangdong/1/1996(H5N1)) OC Viruses; Riboviria; Negarnaviricota; Polyploviricotina; Insthoviricetes; OC Articulavirales; Orthomyxoviridae; Alphainfluenzavirus. XX RN [1] RP 1-865 RX DOI; 10.1006/viro.1999.9820. RX PUBMED; 10484749. RA Xu X., Subbarao, Cox N.J., Guo Y.; RT "Genetic characterization of the pathogenic influenza RT A/Goose/Guangdong/1/96 (H5N1) virus: similarity of its hemagglutinin gene RT to those of H5N1 viruses from the 1997 outbreaks in Hong Kong"; RL Virology 261(1):15-19(1999). XX RN [2] RP 1-865 RA Xu X., Subbarao K., Cox N.J., Guo Y.; RT ; RL Submitted (20-APR-1999) to the INSDC. RL Influenza Branch, Center for Diseases Control and Prevention, 1600 Clifton RL Road, Atlanta, GA 30333, USA XX DR MD5; 8356259e427e65ac347deb820585eb1a. DR EuropePMC; PMC2515872; 18511426. DR EuropePMC; PMC2862710; 20454662. DR EuropePMC; PMC337057; 14745020. DR RFAM; RF01099; PK-IAV. XX FH Key Location/Qualifiers FH FT source 1..865 FT /organism="Influenza A virus FT (A/goose/Guangdong/1/1996(H5N1))" FT /strain="A/Goose/Guangdong/1/96(H5N1)" FT /mol_type="genomic RNA" FT /db_xref="taxon:93838" FT CDS join(15..44,517..852) FT /codon_start=1 FT /gene="NS" FT /product="nonstructural protein 2" FT /note="NS2" FT /db_xref="GOA:Q9Q0L7" FT /db_xref="InterPro:IPR000968" FT /db_xref="UniProtKB/Swiss-Prot:Q9Q0L7" FT /protein_id="AAD51931.1" FT /translation="MDSNTITSFQDILQRMSKMQLESSSVDLNGMITQFERLKIYRDSL FT GESMMRMGDLHSLQNRNATWRNELSQKFEEIRWLIAECRNILTKTENSFEQITFLQALQ FT LLLEVESEIRTFSFQLI" FT CDS 15..707 FT /codon_start=1 FT /gene="NS" FT /product="nonstructural protein 1" FT /note="NS1" FT /db_xref="GOA:Q9Q0L6" FT /db_xref="InterPro:IPR000256" FT /db_xref="InterPro:IPR004208" FT /db_xref="InterPro:IPR009068" FT /db_xref="InterPro:IPR038064" FT /db_xref="UniProtKB/Swiss-Prot:Q9Q0L6" FT /protein_id="AAD51930.1" FT /translation="MDSNTITSFQVDCYLWHIRKLLSMRDMCDAPFDDRLRRDQKALKG FT RGSTLGLDLRVATMEGKKIVEDILKSETNENLKIAIASSPAPRYITDMSIEEMSREWYM FT LMPRQKITGGLMVKMDQAIMDKRIILKANFSVLFDQLETLVSLRAFTESGAIVAEIFPI FT PSVPGHFTEDVKNAIGILIGGLEWNDNSIRASENIQRFAWGIHDENGGPSLPPKQKRYM FT AKRVESEV" XX SQ Sequence 865 BP; 292 A; 161 C; 197 G; 215 T; 0 other; gtgacaaaga cataatggat tccaacacga taacctcgtt tcaggtagat tgttatctat 60 ggcacataag aaagctactc agtatgagag acatgtgtga tgcccccttt gatgacaggc 120 tccgaagaga ccaaaaggca ttaaagggaa gaggcagcac acttggactc gatttaagag 180 tggctacaat ggaggggaaa aagatcgttg aggacatcct gaagagtgag acaaatgaaa 240 acctcaaaat agccattgct tccagtcctg ctcctcggta tatcaccgat atgagcatag 300 aggagatgag ccgagaatgg tacatgctga tgcctaggca gaaaataact ggaggcctta 360 tggtgaaaat ggaccaagcc ataatggata aaagaattat ccttaaagca aatttctcag 420 ttctatttga tcaactagag acattagtct ctctgagggc attcacagaa agtggtgcta 480 ttgtggctga aatatttccc attccctccg taccaggaca ttttacagag gatgtcaaaa 540 atgcaattgg aatcctcatc ggtggacttg aatggaatga taactcaatt cgagcgtctg 600 aaaatataca gagattcgct tggggaatcc atgatgagaa tgggggacct tcactccctc 660 caaaacagaa acgctacatg gcgaaacgag ttgagtcaga agtttgaaga gatcagatgg 720 ctcattgctg aatgtagaaa tatactgaca aagactgaaa atagctttga acagataaca 780 tttttgcaag cattgcaact cttacttgaa gttgagagtg agataaggac cttctctttt 840 cagcttattt aatactaaaa aacac 865 //