ID AF144306; SV 1; linear; viral cRNA; STD; VRL; 1027 BP. XX AC AF144306; XX DT 01-SEP-1999 (Rel. 60, Created) DT 11-JUL-2007 (Rel. 92, Last updated, Version 5) XX DE Influenza A virus (A/Goose/Guangdong/1/96(H5N1)) matrix proteins M1 and M2 DE (M) gene, alternatively spliced products, complete cds. XX KW . XX OS Influenza A virus (A/goose/Guangdong/1/1996(H5N1)) OC Viruses; Riboviria; Negarnaviricota; Polyploviricotina; Insthoviricetes; OC Articulavirales; Orthomyxoviridae; Alphainfluenzavirus. XX RN [1] RP 1-1027 RX DOI; 10.1006/viro.1999.9820. RX PUBMED; 10484749. RA Xu X., Subbarao, Cox N.J., Guo Y.; RT "Genetic characterization of the pathogenic influenza RT A/Goose/Guangdong/1/96 (H5N1) virus: similarity of its hemagglutinin gene RT to those of H5N1 viruses from the 1997 outbreaks in Hong Kong"; RL Virology 261(1):15-19(1999). XX RN [2] RP 1-1027 RX PUBMED; 16318689. RG World Health Organization Global Influenza Program Surveillance Network RA ; RT "Evolution of H5N1 avian influenza viruses in Asia"; RL Emerg. Infect. Dis. 11(10):1515-1521(2005). XX RN [3] RP 1-1027 RA Xu X., Subbarao K., Cox N.J., Guo Y.; RT ; RL Submitted (20-APR-1999) to the INSDC. RL Influenza Branch, Center for Diseases Control and Prevention, 1600 Clifton RL Road, Atlanta, GA 30333, USA XX DR MD5; 9f12a87d019253bba6071636828aad58. DR EuropePMC; PMC337057; 14745020. DR EuropePMC; PMC5876574; 29415432. XX FH Key Location/Qualifiers FH FT source 1..1027 FT /organism="Influenza A virus FT (A/goose/Guangdong/1/1996(H5N1))" FT /strain="A/Goose/Guangdong/1/96(H5N1)" FT /mol_type="viral cRNA" FT /db_xref="taxon:93838" FT gene 26..1007 FT /gene="M" FT CDS join(26..51,740..1007) FT /codon_start=1 FT /gene="M" FT /product="matrix protein 2" FT /note="M2" FT /db_xref="GOA:Q9Q0L9" FT /db_xref="InterPro:IPR002089" FT /db_xref="PDB:6BKK" FT /db_xref="PDB:6BKL" FT /db_xref="PDB:6BMZ" FT /db_xref="PDB:6BOC" FT /db_xref="UniProtKB/Swiss-Prot:Q9Q0L9" FT /protein_id="AAD51929.1" FT /translation="MSLLTEVETPTKNEWECKCSDSSDPLVVAASIIGILHLILWILDR FT LFFKCIYRRLKYGLKRGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE" FT CDS 26..784 FT /codon_start=1 FT /gene="M" FT /product="matrix protein 1" FT /note="M1" FT /db_xref="GOA:Q9Q0L8" FT /db_xref="InterPro:IPR001561" FT /db_xref="InterPro:IPR013188" FT /db_xref="InterPro:IPR015423" FT /db_xref="InterPro:IPR015799" FT /db_xref="InterPro:IPR036039" FT /db_xref="InterPro:IPR037533" FT /db_xref="UniProtKB/Swiss-Prot:Q9Q0L8" FT /protein_id="AAD51928.1" FT /translation="MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEW FT LKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYKKLK FT REITFHGAKEVALSYSTGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHR FT QMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTH FT PSSSAGLKDNLLENLQAYQKRMGVQMQRFK" XX SQ Sequence 1027 BP; 292 A; 218 C; 274 G; 243 T; 0 other; agcaaaagca ggtagatatt gaaaaatgag tcttctaacc gaggtcgaaa cgtacgttct 60 ctctatcgtc ccgtcaggcc ccctcaaagc cgagatcgcg cagagacttg aggatgtctt 120 tgcaggaaag aacaccgatc tcgaggctct catggaatgg ctaaagacaa gaccaatcct 180 gtcacctctg actaaaggga ttttaggatt tgtgttcacg ctcaccgtgc ccagtgagcg 240 aggactgcag cgtagacgct ttgtccagaa tgccttaaat ggaaatggag atccaaacaa 300 tatggatagg gcagttaagc tatacaagaa gctgaaaaga gaaataacat tccatggggc 360 taaggaggtc gcactcagct actcaaccgg tgcacttgcc agttgtatgg gtctcatata 420 caacaggatg ggaacggtga ccacagaagt ggcttttggc ctagtgtgtg ccacttgtga 480 gcagattgca gattcacagc atcggtctca cagacagatg gcaactacca ccaacccact 540 aatcaggcat gagaacagaa tggtgctggc cagcactaca gctaaggcta tggagcagat 600 ggctggatcg agtgagcagg cagcggaagc catggaggtt gctagtcagg ctaggcagat 660 ggtgcaggca atgaggacaa ttgggactca tcctagctcc agtgccggtc tgaaagataa 720 tcttcttgaa aatttgcagg cctaccaaaa acgaatggga gtgcaaatgc agcgattcaa 780 gtgatcctct tgttgttgcc gcaagtatca ttgggatact gcacttgata ttgtggattc 840 ttgatcgtct tttcttcaaa tgcatttatc gtcgccttaa atacggtttg aaaagagggc 900 cttctacgga aggggtacct gagtctatga gggaagagta tcggcaggaa cagcagagtg 960 ctgtggatgt tgacgatggt cattttgtca acatagagct ggagtaaaaa actaccttgt 1020 ttctact 1027 //