ID AF022782; SV 1; linear; mRNA; STD; VRL; 627 BP. XX AC AF022782; XX DT 15-OCT-1997 (Rel. 52, Created) DT 30-NOV-1997 (Rel. 53, Last updated, Version 3) XX DE Potato leaf roll virus coat protein (CP) mRNA, complete cds. XX KW . XX OS Potato leafroll virus OC Viruses; Riboviria; Luteoviridae; Polerovirus. XX RN [1] RP 1-627 RA Murray S.L., Burger J.T., Oelofse D., Cress W.A., Van Staden J., RA Berger D.K.; RT "Transformation of potatoes (cv Late Harvest) with the potato leafroll RT virus coat protein gene, and molecular analysis of transgenic lines"; RL Unpublished. XX RN [2] RP 1-627 RA Murray S.L., Burger J.T., Oelofse D., Cress W.A., Van Staden J., RA Berger D.K.; RT ; RL Submitted (04-SEP-1997) to the INSDC. RL Biotechnology Division, ARC-Roodeplaat Vegetable and Ornamental Plant RL Institute, Private Bag X293, Pretoria, Gauteng 0001, South Africa XX DR MD5; f548a90474b9b32994abf7128723293a. XX FH Key Location/Qualifiers FH FT source 1..627 FT /organism="Potato leafroll virus" FT /isolate="South Africa" FT /mol_type="mRNA" FT /clone="pSK-LR" FT /db_xref="taxon:12045" FT CDS 1..627 FT /codon_start=1 FT /gene="CP" FT /product="coat protein" FT /note="23 kDa protein" FT /db_xref="GOA:O37936" FT /db_xref="InterPro:IPR001517" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:O37936" FT /protein_id="AAB80766.1" FT /translation="MSTVVVRGNVNGGIQQPKRRRRQSLRRRANRVQPVVMVTAPGQPR FT RRRRRRGGNRRSRRTGVPRGRGSSETFVFTKDNLVGNSQGSFTFGPSLSDCPAFKDGIL FT KAYHEYKITSILLQFVSEASSTSSGSIAYELDPHCKISSLQSYVNKFQITKGGAKTYQA FT RMINGVEWHDSSEDQCRILWKGNGKSSDPAGSFRVTIRVALQNPR" XX SQ Sequence 627 BP; 176 A; 160 C; 166 G; 125 T; 0 other; atgagtacgg tcgtggttag aggaaatgtc aatggtggta tacaacaacc aaagaggcga 60 agaaggcaat cccttcgaag gcgcgctaac agagtgcagc cagtggttat ggtcacggcc 120 cctgggcaac ccaggcgccg aagacgcaga agaggaggca atcgccgctc aagaagaact 180 ggagttcccc gaggacgagg ctcaagcgag acattcgtgt ttacaaagga caacctcgtg 240 ggcaattccc aaggaagttt caccttcggg ccgagtctat cagactgtcc ggcattcaag 300 gatggaatac tcaaggccta ccatgagtat aagatcacaa gcatcttact tcagttcgtc 360 agcgaggcct cttccacctc ctccggttcc atcgcttatg agttggaccc ccattgcaaa 420 atatcatccc tccagtccta cgtcaacaag ttccaaatta cgaagggcgg cgctaaaacc 480 tatcaagcgc ggatgataaa cggggtagaa tggcacgatt cgtctgagga tcagtgccgg 540 attctgtgga aaggaaatgg aaaatcttca gatcccgcag gatccttcag agtcaccatc 600 agggtggctt tgcagaaccc cagatag 627 //