ID AB709965; SV 1; linear; genomic RNA; STD; VRL; 303 BP. XX AC AB709965; XX DT 04-APR-2012 (Rel. 112, Created) DT 04-APR-2012 (Rel. 112, Last updated, Version 1) XX DE Cucumber mosaic virus 2b gene for 2b protein, complete cds, strain: KT. XX KW . XX OS Cucumber mosaic virus (cucumber mosaic cucumovirus) OC Viruses; Riboviria; Bromoviridae; Cucumovirus. XX RN [1] RP 1-303 RA Nomura K., Kita N., Uekusa H.; RT ; RL Submitted (02-APR-2012) to the INSDC. RL Contact:Hidetosi Uekusa Kanagawa Agricultural Technology Center; RL kamikisawa1617, Hiratuka, Kanagawa 259-1204, Japan XX RN [2] RA Nomura K., Uekusa H., Kita N.; RT "Cucumber mosaic virus isolate KT, 2b gene"; RL Unpublished. XX DR MD5; fec51d323a48b2dd4c9adb84dee229ef. XX FH Key Location/Qualifiers FH FT source 1..303 FT /organism="Cucumber mosaic virus" FT /segment="RNA2" FT /strain="KT" FT /mol_type="genomic RNA" FT /country="Japan" FT /db_xref="taxon:12305" FT CDS 1..303 FT /codon_start=1 FT /transl_table=1 FT /gene="2b" FT /product="2b protein" FT /db_xref="InterPro:IPR004946" FT /db_xref="UniProtKB/TrEMBL:Q8QHS9" FT /protein_id="BAM09286.1" FT /translation="MDVLTVVVSTADLHLAHLQEVKRRRRRSHVRNRRARGYKSPSERA FT RSIARFFQMLPFHGVDPVDWFPDVVRSPSVTSLVSYESFDDTDWFAGNEWAEGSF" XX SQ Sequence 303 BP; 68 A; 69 C; 85 G; 81 T; 0 other; atggatgtgt tgacagtagt ggtgtcgacc gccgacctcc acctagccca tttgcaggag 60 gtgaaacgtc gaagacgaag gtctcacgtc agaaaccggc gagcgagagg ttacaaaagt 120 cccagcgaga gagcgcgatc tatagcgaga tttttccaga tgttaccatt ccacggagta 180 gatcccgtgg attggtttcc tgatgtcgtt cgctctccgt ccgttaccag ccttgtttct 240 tatgaatctt tcgatgatac tgattggttt gctggtaacg aatgggccga agggtcgttt 300 tga 303 //