ID AB182577; SV 1; linear; genomic RNA; STD; VRL; 486 BP. XX AC AB182577; XX DT 25-JUN-2004 (Rel. 80, Created) DT 03-DEC-2008 (Rel. 98, Last updated, Version 4) XX DE Kyuri green mottle mosaic virus gene for coat protein, complete cds. XX KW . XX OS Kyuri green mottle mosaic virus OC Viruses; Riboviria; Virgaviridae; Tobamovirus. XX RN [1] RP 1-486 RA Daryono B.S., Somowiyarjo S., Natsuaki K.T.; RT ; RL Submitted (23-JUN-2004) to the INSDC. RL Contact:Keiko T Natsuaki Lab. of Tropical Plant Protection, Graduate School RL of Agriculture, Tokyo University of Agriculture, International Agricultural RL Development; 1-1-1 Sakuragaoka, Tokyo, Tokyo 156-8502, Japan XX RN [2] RX DOI; 10.1111/j.1439-0434.2005.01024.x. RX AGRICOLA; IND43756432. RA Daryono B.S., Somowiyarjo S., Natsuaki K.T.; RT "Biological and molecular characterization of melon-infecting kyuri green RT mottle mosaic virus in Indonesia"; RL J. Phytopathol. 153(10):588-595(2005). XX RN [3] RA Daryono B.S., Somowiyarjo S., Natsuaki K.T.; RT "Biological and molecular characterization of melon infecting Tobamovirus RT in Indonesia"; RL Unpublished. XX DR MD5; e6ec716ad95d9dcaffc84951aaeccd3f. XX FH Key Location/Qualifiers FH FT source 1..486 FT /organism="Kyuri green mottle mosaic virus" FT /host="Luffa acutangula" FT /mol_type="genomic RNA" FT /country="Indonesia:Yogyakarta, Sleman, Candisari" FT /note="isolated from Angled loofah" FT /db_xref="taxon:111970" FT CDS 1..486 FT /codon_start=1 FT /transl_table=1 FT /product="coat protein" FT /db_xref="GOA:I7GGY5" FT /db_xref="InterPro:IPR001337" FT /db_xref="InterPro:IPR036417" FT /db_xref="UniProtKB/TrEMBL:I7GGY5" FT /protein_id="BAD24667.1" FT /translation="MSYSISGVRSLPAFAKSFYPFYDLHNLLVKAQGGALQTQNGKDIV FT RESLTGLLTSVASLNTRFPANELFVWSRESRVAAGIDSLLSALDSRNRAIEVENPSNQS FT TGGALNATKRNVDASTAAHNDIPLLLAALNDGVGVFDSASFESAFGLVWTASATSSK" XX SQ Sequence 486 BP; 97 A; 109 C; 118 G; 162 T; 0 other; atgtcttact cgatcagtgg tgttcgttcg cttcctgctt tcgctaagtc cttttatcct 60 ttttatgatt tgcataattt gttggttaaa gcccaaggag gtgctcttca aacgcagaat 120 ggtaaagaca ttgtgcgcga gtccctcact gggttgttaa cttctgttgc gtctctaaat 180 acacgttttc ctgctaatga gcttttcgtg tggtctcgtg agtcgcgcgt tgctgctggg 240 atcgattctt tgttatccgc attggattct agaaataggg ctatcgaagt tgagaacccc 300 tctaatcaat ctactggggg agctttgaat gcgactaagc gcaatgtcga cgcgtctaca 360 gccgcacaca acgacattcc tctgctgtta gcagctttga atgacggtgt gggcgttttt 420 gatagtgcgt cttttgagtc agctttcggt cttgtttgga ccgcaagcgc cacttcctct 480 aaatga 486 //