ID AB091835; SV 1; linear; genomic RNA; STD; VRL; 762 BP. XX AC AB091835; XX DT 04-APR-2006 (Rel. 87, Created) DT 13-DEC-2008 (Rel. 98, Last updated, Version 3) XX DE Ornithogalum mosaic virus cp gene for coat protein, partial cds, isolated DE from Ornithogalum thyrsoides. XX KW . XX OS Ornithogalum mosaic virus OC Viruses; Riboviria; Potyviridae; Potyvirus. XX RN [1] RP 1-762 RA Yamamoto H., Fuji S., Inoue M., Matsumoto T.; RT ; RL Submitted (19-SEP-2002) to the INSDC. RL Contact:Hideki Yamamoto Akita Agricultural Experiment Station, Department RL of Biotechnology; Higashi 1-1, Ohgata, Akita 010-0442, Japan XX RN [2] RA Yamamoto H., Fuji S., Inoue M., Matsumoto T.; RT "Coat protein gene of OMV isolated from O.thyrsoides"; RL Unpublished. XX DR MD5; 251e6e45e6cfeda1da2013beb0ae2495. DR EuropePMC; PMC5877448; 29607262. XX FH Key Location/Qualifiers FH FT source 1..762 FT /organism="Ornithogalum mosaic virus" FT /host="Ornithogalum thyrsoides" FT /isolate="7-3" FT /mol_type="genomic RNA" FT /country="Japan:Akita" FT /db_xref="taxon:12204" FT CDS <1..762 FT /codon_start=1 FT /transl_table=1 FT /gene="cp" FT /product="coat protein" FT /db_xref="GOA:Q1XIS1" FT /db_xref="InterPro:IPR001592" FT /db_xref="UniProtKB/TrEMBL:Q1XIS1" FT /protein_id="BAE92899.1" FT /translation="AESMDAGGSNRPPAPLVRQQDQDVNAGTFSVARVKALSDKMMLPK FT VRGKTVLNLQHLVQYNPEQTEISNTRATRTQFNNWYDRVRDSYGVTDDQMAVILNGLMV FT WCIENGTSPNLNGNWTMMDGDEQIEYPLQPVLENAQPTFRQIMAHFSNAAEAYIEKRNS FT EQRYMPRYGSQRNLNDYSLARYAFDFYEMTSRTPNRAREAHIQMKAAALRNTKTKLFGL FT DGKVGTEEEDTERHVASDVNRNMHSLLGVNM" XX SQ Sequence 762 BP; 237 A; 162 C; 193 G; 170 T; 0 other; gcggaatcca tggatgctgg tgggtcaaac agaccaccag cgcctctggt tcgtcaacaa 60 gatcaagatg tcaacgctgg aacattttct gttgcacgag tcaaggcgtt gagcgataaa 120 atgatgttac ccaaggtgcg cggtaaaacg gtgcttaatt tacagcatct ggtgcagtac 180 aaccctgagc aaactgaaat ctcaaacact cgtgccacac gaacacagtt caacaattgg 240 tacgataggg ttagagatag ttatggggtt acagatgacc aaatggctgt tatcctaaat 300 ggtttgatgg tgtggtgcat cgagaatggc acttcaccaa atttgaatgg taattggacg 360 atgatggatg gcgatgagca gatcgaatat cctttgcaac cagtccttga gaatgctcag 420 ccaacattca gacaaattat ggcgcatttc tcaaacgcag ccgaggcgta catcgaaaag 480 agaaactcgg aacaaaggta catgccaagg tacggcagcc aacgaaatct gaacgactac 540 agcttggccc gctatgcatt tgacttttat gaaatgacat cccgaacgcc caacagggcc 600 agggaagcac atatacaaat gaaagcggca gctcttcgga acaccaaaac gaagttgttt 660 ggtttagatg ggaaagtggg taccgaggaa gaggacacag aacggcatgt tgcaagcgat 720 gtcaatcgca acatgcattc actacttggt gttaatatgt ga 762 //